KEGG   Ostreococcus lucimarinus: OSTLU_94760Help
Entry
OSTLU_94760       CDS       T01029                                 

Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
olu  Ostreococcus lucimarinus
Brite
Enzymes [BR:olu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     OSTLU_94760
Protein kinases [BR:olu01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   OSTLU_94760
Exosome [BR:olu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   OSTLU_94760
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 405 aa AA seqDB search
MTSAKRRKARREREGRSGRGTAAVTSKFAVCGTVFEVDAKYAPIKPIGKGAYGVVCSARE
LETNRKVAIKKIVNAFENVVDAKRTLREIKLLRHLRHENVIDIIDCVKPRAKDAFEDVYL
MYDLMDTDLYQIIRSSQSLTDEHCQYFVYQILRGLKYIHSADVLHRDLKPGNLLLNANCD
LKICDFGLARTALVDAEASEFMTEYVVTRWYRAPELLLSCAEYTSAIDVWSVGCIFAELL
GRKTLFPGKDYVHQLNLIMRVIGTPQNPSELDFINNEKAKRYIKSLPVTARCSFQKLFPN
ASPKAVDLVDKMLVLDPARRITVEEALAHPYLESLHDEVDEPCAESPFTFDFEDGAQYLT
DTDVRGLIYDELCALSAEFEAAKLAQLSLGGDGQDEGNELSELLL
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcggcgaaacgacgaaaggcgcgacgggagagggaaggacggtcgggacggggg
acggcggcggtgacgtccaagttcgccgtgtgcgggacggtgttcgaggtggacgccaag
tatgcgcccataaaaccgatcgggaagggggcgtacggggtggtgtgtagcgcgagagag
ttggagacgaatagaaaggtggcgattaagaagattgtgaacgcgttcgagaacgtggtg
gacgcgaagcggacgctgcgggaaatcaagctgttgcgacacttgaggcacgagaacgtg
atcgatatcatcgattgcgtgaaacctcgcgcgaaggatgcgtttgaggacgtttatttg
atgtacgatctcatggacaccgatttataccaaatcattcgcagttcgcagtcgctgacg
gatgagcactgtcagtactttgtctatcagattttgcgcgggttaaagtacattcacagc
gccgacgtgctgcatcgagacttgaagcctggaaatttattattgaacgcgaactgcgat
ttgaagatttgtgactttggattggcgcgcaccgcgctcgtggacgcggaggcgtccgag
ttcatgacggagtacgtcgtgacgaggtggtatcgcgcgcccgagctgttgctctcttgc
gccgagtacacgagcgctatcgatgtgtggagcgtcggttgtatcttcgccgagttgctc
gggcgaaagacgctctttccggggaaagattacgtgcaccaattgaatttgatcatgcgc
gtcatcggaacgccgcaaaacccatccgagcttgatttcatcaacaacgaaaaggcgaag
cgttacatcaaatcacttccagtcaccgcgcgatgtagctttcaaaagttgttccccaac
gcttcgcccaaggcggtggacttggtggataagatgctcgtgctcgacccggcgaggcgc
atcaccgtcgaggaggcgttggcgcatccatacctggaatcgcttcacgatgaagtcgac
gaaccgtgcgctgagtcgccgttcaccttcgactttgaagacggtgcccaatatctgaca
gataccgatgttcgaggtttgatttacgacgaactgtgcgcgttgtccgcggaattcgaa
gcggcaaaactcgcacaactttcgctcggcggcgatggacaagacgaaggaaatgaactc
tctgaactgctactataa

DBGET integrated database retrieval system