KEGG   Oscillatoria nigro-viridis: Osc7112_0105Help
Entry
Osc7112_0105      CDS       T02375                                 

Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:oni00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:oni00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
120079..120624
Genome map
AA seq 181 aa AA seqDB search
MNVISTEIPEVLIVEPKIFGDDRGFFFESFNHKAFVEKTGVTAEFVQDNHSKSSKNVLRG
LHYQMQQPQGKLLRVVAGEIFDVAVDIRKSSPTFGQWVGCLLSSENKRQFWVPAGFAHGF
LVVSQTAEVLYKTTDYYAPAHERCILWNDPDLAIDWPLDGAQPILSAKDQAGQTLKRAQV
F
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaatgttatatctaccgaaataccggaagttctgatcgttgagcctaaaattttcgga
gacgatcgcggtttcttttttgagagtttcaatcacaaagcttttgtcgaaaaaacaggc
gtgacggccgaatttgttcaagacaatcattccaaatcttctaaaaatgtcctgcgcggt
ttgcactaccaaatgcagcagcctcaaggcaaattgctgcgggtagttgcaggcgaaata
tttgacgtagcggtggatattagaaaaagttcgccgacttttggccagtgggtgggctgt
ttgctgagttcagaaaataaacggcaattttgggtgccggcgggatttgcacacggtttt
ttagtggtttcccagacggctgaagttttgtacaaaactacagactactatgcaccagcc
cacgagcggtgtatcctgtggaatgacccggatttggcgatcgactggccgctagatggt
gcccaaccaatcttatcagctaaagaccaagctggacaaacgttgaaaagagctcaagtg
ttttga

DBGET integrated database retrieval system