KEGG   Oscillatoria nigro-viridis: Osc7112_0115Help
Entry
Osc7112_0115      CDS       T02375                                 

Definition
UDP-N-acetylglucosamine1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:oni00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:oni00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
137053..138471
Genome map
AA seq 472 aa AA seqDB search
MYKVTKRIMEGKPITPAQNSSNVPASPESDQEVLQIWGRQPLKGHVKISGAKNSALVVMA
GTLLCPEDCRLRNVPGLVDVARMGQILSAVGVKLQQNGDVLDINASNLIDAQAPYELVSQ
LRASFFIIGPLLARLGFAKVPLPGGCAIGARPVELHVRGLQALGAEVHIDHGTVHAYVKG
PNRRLKGAKIYLDYPSVGATETLMMAATLAEGETVIENAAQEPEVADLANFCRAMGAKIQ
GAGTNTIVISGVPKLHAVDYSIIPDRIEAGTFLVAGAITHSEISLSPVIPDHLTAVIAKL
QTIGAKIIAESPDILRIVPGQTHSATDIETLPYPGFPTDMQAQFMALLTLSQGDSLIKET
VFENRLRHVAELNRMGADIRLKGNVAIVRGVPLLSGAPVVATDLRASAALVLAGLAADGV
TTISSLQHLDRGYEQLEVKLQKLGAKLRRVKEGTDPATAEAPVNPVRSGLNC
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgtataaagtaacgaagcgcattatggagggcaaacccattacaccagctcagaactca
tctaacgtcccagcttcacctgaaagcgaccaagaagtattgcaaatttggggtcgccag
ccccttaaaggacacgtcaaaatcagcggcgccaaaaactcggccttagtcgtcatggca
ggaaccctgctatgcccagaggattgccgtctccgcaacgttcccggtctagtcgatgtc
gcccgcatggggcaaattctctcggctgtaggagtcaaattacagcaaaacggcgacgtt
ttagacatcaacgccagcaacctcatagacgctcaagccccctacgaattagtcagccaa
ctgcgggcgagcttcttcatcatcggcccgctgctagcgcgtttgggatttgccaaagta
cccttgcccggtgggtgcgccatcggcgcgcgacccgtggaactccacgttcgcggtctg
caagccctcggcgccgaagtccacatcgaccacggcacggttcacgcttacgtcaaaggg
ccgaaccgccgcctgaaaggagccaaaatttatttggactaccccagcgtcggcgcaact
gaaactttgatgatggcggcgactttggctgaaggagaaaccgtgattgaaaatgcggct
caagagccggaagtcgcagatttggcgaatttctgccgcgctatgggagcaaaaattcaa
ggcgcaggcacgaatacgatcgtcatttcgggagttcccaagctgcacgcggtagactat
tcaattattcccgatcgcattgaagccggaacatttttagtagcaggagccatcactcac
tccgaaatcagtttgtcgccggtaattcccgaccacctgaccgcagtcattgccaaattg
cagacaattggggcgaaaattattgcagaatcccccgacattttgcggatagttcccggc
caaactcactcggccaccgacatcgaaactctgccttatccgggtttccccacagatatg
caagctcagtttatggctttgctgacgctgagccaaggagacagcttgatcaaagaaacc
gtgtttgagaatcgcttgcgccacgtagcagagctcaaccgcatgggcgccgacattcgc
cttaaaggcaatgtagcgattgtgcgcggagtgccgctgctgtcgggtgcgccggtagtg
gctacagatttgcgggcttcggcggcgttagtgctagcgggacttgcagccgatggtgtc
accaccatcagcagcttgcagcacttagaccgcggctacgagcagttagaggtgaaactg
caaaaattgggagctaagttgcgacgggtcaaagagggcacagacccggcgactgctgag
gctcctgtcaatcccgtgcgatcgggtttaaactgttaa

DBGET integrated database retrieval system