KEGG   Oscillatoria nigro-viridis: Osc7112_0611Help
Entry
Osc7112_0611      CDS       T02375                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Osc7112_0611
Enzymes [BR:oni01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Osc7112_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
701899..703407
Genome map
AA seq 502 aa AA seqDB search
MLFPRSSGMLLHPTSFPSRFGIGDMGIEAYRFIDFLVESDQQYWQVLPLGPTGYGNSPYS
CYSAMAGNPLLINPELLRDQQLLGDEDFANLPEFPLDYVDFDRAIALKVPLLKKASENFK
AKASPIQQKEFSAFCESKENWLEDYALFMALKDNFGGVSWNNWEPEIARREPESVEKWLQ
QLNAEIYYYKYVQFEFFRQWTELKRYANLRDIKIIGDIPIYVAHDSADVWSHPEIFCLDE
ASGEPALMAGVPPDYFSSTGQLWGNPVYNWEKLQATNFEWWVQRFEAIFAYVDVTRIDHF
RGFEAYWAVKRGQETAIEGEWIKAPGTALLDLINEKFGNLPIIAEDLGVITPEVEALRDR
YEFPGMKILQFAFGAGPGDPFLPFNYDRNCVVYTGTHDNDTTVGWFNQLQNYERDEVLRY
LGCIDPQGIHWSLIRMGWMSIANMAIVPFQDLLGLDTDARMNFPGKPEGNWGWRYRPEAL
NWEVRDRLKTMTYISGRAPNKH
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgctttttccccgatcgagtggtatgctactccaccccacatcctttcccagtcgattt
ggcattggggacatgggaatagaagcatatcgctttattgactttttagttgagagcgac
cagcaatactggcaggtattgccgctcggcccgacaggatacggcaattctccttattcg
tgctattcagcaatggcgggaaatcccctgctaattaacccagaactgctgcgggatcag
caattgctcggagatgaagacttcgctaatttgcccgaatttccgctggattatgtagac
ttcgatcgggcgatcgccctgaaagtacctttgctcaaaaaagctagcgaaaacttcaaa
gccaaagcatccccgatccagcaaaaagaattctcagctttttgcgaaagcaaagagaat
tggctggaagattacgccttatttatggcactaaaagataactttggcggtgttagctgg
aacaattgggaaccagaaattgcccgtcgagaaccagagtcggtagagaagtggcttcag
cagctaaatgctgagatttattactacaaatacgtccagtttgagttttttcgccagtgg
acggagttgaaacgctatgctaacctgcgggacattaaaattattggcgacattccgatt
tatgtagctcacgacagcgcggatgtatggtctcatccagaaatattttgcttggatgaa
gccagcggagaaccagctttaatggcgggtgttccccctgattacttcagcagtacaggt
caattgtggggcaaccccgtatacaattgggagaagttgcaagcaactaatttcgagtgg
tgggtgcagcgttttgaagcgattttcgcttatgtagacgtgactcggatcgaccacttt
cgaggatttgaggcttactgggcggtgaagcgcggacaagaaactgcgatcgagggagag
tggattaaagcgccgggaacagctttgttggatctaattaacgagaagtttggcaacttg
ccgattatcgctgaggatttaggggtaattactccggaagtggaagctttgcgcgatcga
tacgagtttccaggaatgaagattttgcagtttgctttcggagcgggccctggcgatcct
tttttgcctttcaattacgatcgcaattgcgtagtttacaccggtacccacgacaacgac
acgactgtcggttggttcaatcaactgcaaaactacgaaagagatgaggttttgcgttat
ttgggctgcatcgatccccaaggaattcactggtctttaatccgcatgggttggatgtct
attgctaatatggcaattgtgccttttcaagatttgttgggtttagatactgacgcgcgg
atgaattttccggggaaaccagagggaaattggggatggcggtatcggcccgaagcttta
aattgggaagtgcgcgatcggctcaaaaccatgacttacatctccggccgcgctcctaat
aaacattga

DBGET integrated database retrieval system