KEGG   Oscillatoria nigro-viridis: Osc7112_0811Help
Entry
Osc7112_0811      CDS       T02375                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00330  Arginine and proline metabolism
oni00332  Carbapenem biosynthesis
oni01100  Metabolic pathways
oni01130  Biosynthesis of antibiotics
oni01230  Biosynthesis of amino acids
Module
oni_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Osc7112_0811
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Osc7112_0811
Enzymes [BR:oni01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Osc7112_0811
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA SelB-wing_1
Motif
Other DBs
NCBI-ProteinID: AFZ05395
UniProt: K9VDR1
Position
complement(931704..932813)
Genome map
AA seq 369 aa AA seqDB search
MTKTIVVKIGTSTLTRSTTGNLALSTIAALVEILADLRQQGHRVVLVSSGAVGVGCARLG
LTERPRNIALKQAVAAVGQGRLMRVYDDLFTTLQQPIAQVLLTRGDLVQRNGYVNACNTF
GQLLRLGVIPIVNENDTVAVDELKFGDNDTLSALVASLVEADWLFVLTDVDRLYSADPRS
NPDAQPIALVQSMAQLTEFQVQTGDSRSGWGTGGMVTKIEAARIATASGVRTVITDGCFP
GNIEKILNGESIGTQFEPQPRPVNARKHWIANVLIPAGKLYLDAGAVKAISHGGKSLLAA
GIAQVEGEFQADDSVQLCDAAGKQIARGLVNYNSLELRQIQGCKSDKIAEILGYAGVETA
VHRDNLVIV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaactattgttgttaaaattggaacttcgactctgactcgatcgactacagga
aacttagctctttcaactattgctgcattggtcgaaattttagctgatttgcggcagcaa
ggtcatagagtagttttggtttcttcgggtgcggttggggttggctgcgcgcgcttgggt
ttgacggaacgcccgcgaaatattgctctgaaacaggctgtggcggctgtgggccaaggg
cggctgatgcgggtgtacgatgacttgtttactactctacaacagccgatcgctcaagta
ttgctcacccggggcgatttagtgcagcgtaacggttatgttaacgcttgcaatactttt
gggcaactgctgaggttgggcgtgattccgatcgtcaatgaaaacgatacagtagccgta
gacgagctcaaatttggcgataacgacacgctttcggcgctagtagcgagtttggtagaa
gcagattggttgtttgtactcacagatgtcgatcggctgtattcggcagatccgcgcagc
aatcccgacgcgcagccgatcgccctagtccaaagtatggcacagctaacagaatttcag
gtgcaaacaggagattcccgcagcggttggggaaccggcggaatggtgacaaaaattgaa
gcggcgagaatagcaactgcatcgggagtgcggactgtcatcactgacggctgctttcct
ggtaatatcgagaaaatactcaacggagagtcgatcggtactcaattcgagcctcaaccg
cgccctgtaaacgctcgcaaacactggatagctaacgtgctaattccggcaggaaaacta
tatttagatgcgggtgctgtcaaggcaatttcccacggcggaaaatcgcttttagctgcg
ggtattgctcaagtagaaggagaatttcaagctgatgattccgtgcagttgtgcgacgca
gccggcaagcaaattgctagaggacttgtgaattataacagtttagaattgagacaaatc
cagggctgcaagtccgataaaattgctgagattttaggctatgcgggtgtagaaactgcg
gtacaccgagataatttagtgattgtttaa

DBGET integrated database retrieval system