KEGG   Oscillatoria nigro-viridis: Osc7112_0852Help
Entry
Osc7112_0852      CDS       T02375                                 

Definition
Protein-arginine deiminase (EC:3.5.3.15)
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
oni  Oscillatoria nigro-viridis
Brite
Enzymes [BR:oni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     Osc7112_0852
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
969694..972306
Genome map
AA seq 870 aa AA seqDB search
MRWVRYIAIAIINGFGVVIGIIWVAVPATVAQPSLNYQLALSGRQPDGENPQSLSELYKL
RDRLKVQLDNLAKTSDSAPFLAELWQSAIHRQQSQTLTQQLQNVQIQIQIEERAKYNWDD
AAKLAAQAVEIGRTSNPSSATWEQSQRLWQLAINTLRLIPHDSFLADGAIDKTIEYQGNL
SAATYEMQVARSVEKVRAEEEEIRERARQEQEKKEFARRERERKEQEKKDRARKELERQE
FERQELARKKIERQELARKEIERQEFERQELARKEIERQEFERQELARKEIERQELARKE
VERQELERQELARKELERQELERNQQATPQPTPESTAIPTPALVTAAASPSNFFFAGDTN
RDGQINEQDEAGKEQWSLSKGALILFNDRNNDRGKIPTWKQTKVNTPRRAAMLSQVNLTL
SENFKTSQLFITADSIASPHISVFQKTGDGWQPVDISGAKPLVFSTNIVLGVEAKQFADR
NWNGTVNLKATALNNGQEIASTTIQMGVSPWMIPPNTAPVTEIQVSDRGSVNSEFISQLK
QAVEPTGAQVKILQGDRTWMQDTQKNGYVQLPDKSAIRLFNVAIKSNSEQDKNPPVKSTQ
NRDLKVFKIGNPRSLDPVSQWSDGYGNLQVTPPIPGHPLGRVYYGNSGNASFNPEVLDFI
QAQRIQGPPVDIDTSWLLTRQVDEIINFIPTQTPGQYVMAIASPEAGVKLLQELEGRGYG
DVTINRGLSTQTTVSAALKNRALIQHNLYLQKQKLNPIIEKLKREFLLRDDQIVQVPVMF
GYSGYAWWPNMVNSVPVNGKLLVSNPRGPMIDGVDYTQERLRQLLLPAGVSVSFLDDRYY
QELKGNVQSATNTVRKPEERPFWQSLPNNY
NT seq 2613 nt NT seq  +upstreamnt  +downstreamnt
atgcgctgggttcgatatattgcgatcgccattatcaatggtttcggtgtcgtcatcggt
attatttgggttgcagtccccgcaacagtggctcaaccttccctaaactaccaactcgca
ctctctgggcgacagccagacggcgaaaatccgcaatccctttcggaactctacaaattg
cgcgatcggctcaaagtacaattagataaccttgccaaaacttccgacagcgccccgttt
cttgcagaactttggcaatcagcaatccaccgccagcaatcccaaactctgacgcagcaa
ctccaaaacgttcaaattcagattcaaatagaagaaagagccaaatataattgggacgat
gctgctaaattagccgcccaagcagtcgaaattggacgcacttctaatccttcttctgct
acttgggaacagtcccagcgcctgtggcagttggctatcaatacgctgcgactcattcct
cacgattcttttttggctgatggggcgatcgacaaaaccatcgaataccaaggaaacctc
agtgccgctacctatgaaatgcaagttgcacgttctgttgagaaagttagagccgaggaa
gaagagataagagagcgagcccgccaagagcaagagaaaaaagaatttgctcgtcgagaa
agagagcgaaaagagcaagagaaaaaagaccgggctagaaaagaacttgaaaggcaagaa
tttgagaggcaagaattagccagaaaaaaaatagaaaggcaagaattagccaggaaagaa
atagaaaggcaagaatttgagaggcaagaattagccaggaaagaaatagaaaggcaagaa
tttgagaggcaagaattagccaggaaagaaatagaaaggcaagaattagccaggaaagaa
gttgaaagacaagaacttgaaaggcaagaattagccagaaaagaacttgaaaggcaagag
ttagagagaaatcagcaagcaactcctcaaccaactcctgaatcaactgcaataccaact
cccgccctagttacggccgccgcgtcgccgtcgaactttttctttgcaggagatactaac
agagatggccaaattaacgagcaagacgaagccggaaaagaacaatggtctttgtccaag
ggcgcgctaattttatttaacgatcgcaataacgatcgcggcaagataccgacttggaaa
caaaccaaagttaacactccccgccgtgcagcgatgctttctcaagttaacttaacactg
tctgaaaacttcaaaacatctcaactatttatcacggctgacagcattgctagccctcac
atcagcgtttttcagaagacgggtgacggctggcaacctgtagatatatccggcgctaaa
cctctagttttcagcacgaatattgttttaggtgtggaagccaaacaatttgccgatcgc
aattggaacggcactgtaaatctcaaagcgactgccctaaacaacggtcaagaaatcgcc
tccacaacaatccaaatgggcgttagtccttggatgataccgccaaatacagcaccagta
accgaaattcaggtcagcgacagaggctcggtcaacagcgaatttatctcgcaactaaaa
caagcagtagaacccacaggcgcccaagtaaaaattctccagggcgatcgcacttggatg
caagatacccagaaaaacggctacgttcaattgccagacaaatcggcaatccgcctgttt
aatgtagccataaaaagcaatagcgagcaagataaaaacccgcctgttaaatcaactcaa
aaccgggatttgaaagtatttaaaattggcaatcctcgctctttagaccctgtaagtcag
tggtctgacggatacggcaatttgcaggtgacaccgccgattcccggacacccactgggt
cgagtttattacgggaattcgggaaatgctagttttaatccagaggtacttgattttatt
caagctcagagaattcaagggccgccggtggatattgatacttcttggcttttgactcgc
caagtcgatgaaattatcaattttattcccactcaaactcccggacaatatgtaatggca
atcgccagtcccgaagccggagttaagctgttgcaagaattggagggaagaggttacggc
gatgtgacgatcaatcgcggtttgagcactcaaacaacagtcagcgccgccttgaaaaac
cgtgctttaattcaacacaatctctatttgcaaaagcagaaacttaatccgattatagag
aagttgaaaagagagtttttactccgagacgaccaaattgttcaagttccggtgatgttt
ggctacagcggttatgcttggtggccgaatatggtcaattcggtgccagttaacggcaag
ttgttagtttcaaatccgcgcgggccaatgattgacggtgtagattacactcaagaaaga
ttgcgccaactgctgctgcctgctggcgtcagcgtgagttttctggatgacaggtattat
caagaattaaaaggaaacgtgcagtcggcaacgaatactgtgaggaagccagaagagcgg
cctttttggcagtctttgcctaataattactaa

DBGET integrated database retrieval system