KEGG   Oscillatoria nigro-viridis: Osc7112_0948Help
Entry
Osc7112_0948      CDS       T02375                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:oni00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1100003..1100737
Genome map
AA seq 244 aa AA seqDB search
MTIASSTDSNGSNSLSTDSMKLSETADNNTPRIPTRPDRNSSHGQESSVPIASEVGLEEM
MEAVRTMLLGVGEDPEREGLLKTPKRVAEAMRFLTSGYSQSLEELLNGAIFDEGHNEMVL
VRDISVFSMCEHHMLPFMGRVHIAYIPNQKVVGLSKLARIAEMYSRRLQVQERLTRQIAE
AVQTILEPKGVAVVMEASHMCMTMRGVQKPGAWTVTSAMLGVFQEEQKTREEFLNLIRHQ
PTFF
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgcatcttccaccgattccaatggctcgaactcactctcgactgacagcatg
aaactttcagaaaccgcagacaacaacaccccgcgcatcccaactcgacccgatcgcaat
tcctctcacggtcaagaatccagcgtgcccatagcttcagaagtagggctggaagaaatg
atggaggccgttcgcacaatgctgctgggagtaggagaagatcccgaacgcgaaggattg
ctcaaaaccccaaagcgggtagcagaagcaatgcggttcctcaccagcggctacagtcaa
tccctcgaagaactcctcaacggcgctatctttgacgaaggccacaacgaaatggtactg
gtacgagacatcagcgtattcagtatgtgcgaacaccatatgctgccgtttatgggccga
gttcacatcgcttacattcccaatcaaaaagtagtgggactgagcaaattagccagaata
gccgagatgtacagccgccggttgcaggtgcaggaacgtttgacacgtcaaattgccgaa
gcagttcagacaatattggaaccgaagggagtagctgtagtcatggaagccagccatatg
tgcatgacgatgcggggcgtgcaaaaacccggtgcttggacggttacgagtgccatgttg
ggcgtgtttcaagaggaacagaaaactcgcgaagaattcctgaatttgatccgccaccaa
ccgacattcttttag

DBGET integrated database retrieval system