KEGG   Oscillatoria nigro-viridis: Osc7112_0983Help
Entry
Osc7112_0983      CDS       T02375                                 

Definition
signal transduction histidine kinase with CheB and CheR activity (EC:2.1.1.80 3.1.1.61)
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:oni00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Osc7112_0983
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Osc7112_0983
Enzymes [BR:oni01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Osc7112_0983
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Osc7112_0983
Two-component system [BR:oni02022]
 CheA family
  CheA-CheYBV
   Osc7112_0983
Bacterial motility proteins [BR:oni02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Osc7112_0983
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1133766..1137983
Genome map
AA seq 1405 aa AA seqDB search
MTSPQLSPENTPESIAPAALDREQLTETDAPFPIVGIAASAGGLEAFTQLLSHLPSDTGM
AFVLIQHLAPDHKSLLSEILARTTQMPVNEVEDGVAVEPNQVYVIPPNTKMVLSKGVLQL
SPREKIYGKYLPGDAFFTSLAIDRGHKAIAVVLSGGDGDGSLGLNAIKAAGGMTFAQCQD
TAKFDSMPITAVATGNVDFVLPPEKIAEELANYSHNPLLTGPLAMTKVEESPEQGDALAT
IFALLKSTTGVDFSHYKPTTIARRIQRRMVLYKLESLDDYAQHLRHNSAEVTALYEEILI
HVTSFFRDPEAFEKLKELVFPTITQNKSAETPIRIWVAGCSTGEEVYSIAICLLEFLGDR
AIQPPIQIFATDIGEQAIGKARSGVYSENQMVDVSPERRTGYFIAQEEGSYRISKAVREL
CVFARQDLGSDPPFSNLDLVSCRNVLIYLGESLQKKLMPIFHYSLNPNGFLLLGTSESTG
KFSYLFTSVDKNSKIYAKNLTATRPTFSFTPSSYPVAKARERQEVKENLTNSFDLQRETD
QLILNRYALAGVVVNDLMNILQVRGDINPYFRLAFGTPDLNLLTMAREGLLLELRTAIYQ
AQTQNVTVRKEGVSVVESAGRSSIVNFEVIPFQPQAVEGRYFLVLLEQASPPMLKLTPLP
SESFEQADLVREIDLLRQALATAYQDKTAVQTQLQAVIQEHENLNQDIKIANEEILSSNE
ELQSTNEELETAKEEIQATNEELTTTNEELRSRNIEQSLVNNDLINLLSSINIPILMLTN
DLQIRRFTPTAQQIFSVIPTDVGRPFSDIRSTLNVPGLEQMILEVIDTLQTKEQEIQTLS
GYWYNLRIRPYRTTENQIDGVVMVLLDIDALKRSARTLEEARNYAETIVETVQTPLVALD
ANFRVNKANRAFYETFQISSSETAQSSLFELGNGQWNIPQLRWILEDILVSDVQLENFEL
THLFEKIGQKTMLLNACKLQREDQALMILLSIEDITERKQFEKVRSQLFEHEQLARQQAE
TANRAKDEFLANLSHELRNPLTPILGWSQILRSGKLKGVAVTKALEVIDRSARAQSQLIE
DILDISRITSGKLQLCICPIDLRLVVQAAVEGVQLSAEAKNIQIVSELISTSVLGDINRL
QQVVWNLLSNAIKFTPAGGRVEILLSAIDNHAQLRVSDTGKGIEAQFLPYIFDRFHQGDS
SSVKANQGLGLGLSIVRHLVELHGGTVQAESPGEGQGTTMTVRLPLRSLPQELTSAIDLK
STALAGPLNASSDRVPSLEGLHILAVDDQIDTRDFLQFVLEGYGAEVLAVASARSAIAAL
TENPGRYDVLISDLGMPEEDGFFLIREVRALAAEAGGEIPAAALTAYAGNKEREMAIEAG
FQRHMVKPIEPVVLGLMVANLVGRF
NT seq 4218 nt NT seq  +upstreamnt  +downstreamnt
atgacttctcctcaattatctccagaaaatacacccgaatcgatcgcaccagccgccctc
gatagagaacaattaaccgaaaccgatgccccctttcccattgttgggattgctgcctca
gcaggagggttggaagcattcacgcagttactgagccatttaccgagcgatacgggtatg
gcgtttgtgctgattcagcatttagcccccgatcacaaaagtctgctgagcgagattctc
gcgagaacgacgcaaatgcctgtgaatgaggtagaagacggcgtagctgtagaacccaat
caagtctacgttattccgcccaataccaagatggtgctatctaaaggcgtgctgcaacta
tcaccgcgcgagaagatttacggcaaatatctgccgggagatgcgttttttacctcattg
gcgatcgatcgcgggcacaaagcaatcgccgtagttttatccgggggagacggagacggt
tcactcgggctcaacgccatcaaagcagccggaggcatgacgtttgctcaatgtcaagac
acggcaaaattcgacagtatgccgattaccgctgttgccacaggaaatgtcgatttcgtt
ctgccaccggaaaaaattgccgaggaactggcaaactacagtcacaatccccttctcact
ggcccgcttgccatgacaaaagttgaggaatcgcccgaacagggagatgccctggcaact
atttttgcgctgctgaaatcgaccacaggggttgattttagccactacaaacccacgacg
atcgctcgacgcatccagcgacggatggtgttgtacaagctggaaagcttggatgattac
gcccaacatcttcgacacaattcggctgaagtcacagccctgtatgaagaaatcctgatc
cacgttaccagtttcttccgtgaccccgaagcctttgaaaagttaaaagaactggttttc
cccacgattacccaaaataaatcggccgaaactccgattcggatttgggtggcgggatgt
tccacaggtgaagaagtttattcgatcgcgatttgcttgttagagtttttgggcgatcga
gccatccagccaccgatccagatttttgccacggacattggcgaacaggcaattggcaaa
gcgaggtctggcgtctactcagaaaaccagatggtagatgtttcaccagaacgacgtact
ggctactttattgcccaagaagaaggtagctatagaatcagcaaggcagtccgcgaactg
tgtgtatttgcccgacaagacttaggcagcgacccgcctttttccaatctcgatttagtt
agctgtcgcaatgtgctgatctacttgggagagtcattgcaaaaaaaattgatgcccatt
tttcattacagtcttaacccaaatggctttctgttgttaggcacttctgagagtaccgga
aaattctcatacttgtttacttcagtggataaaaactctaaaatttatgccaaaaacttg
acggcgactcgtccgactttttcgtttacgccgagttcctatcccgtagctaaagcacgt
gaacggcaggaagtgaaggaaaatttgacaaatagctttgatttacagcgagaaacagac
caactgattttgaatcgctatgccctagcaggtgtggttgtcaacgatctcatgaacatc
ctgcaagtgcggggagacatcaatccttacttcagattggccttcggaacgcccgactta
aacttgctgacaatggcaagggaaggcttgctgcttgagcttcgcaccgctatttatcag
gcacaaacgcagaacgtgaccgttaggaaagaaggggtatcggttgttgaatcggccgga
cgatcgagtatcgtcaattttgaagtgattccgttccagccacaggcggttgaaggacgc
tactttttggtgctattggaacaggcttcacccccaatgcttaaactcacacccctccct
tctgaaagcttcgagcaagctgatttagtgcgcgaaattgatctgctgaggcaggcactt
gcaaccgcttaccaagacaaaactgcggttcaaacgcaactgcaagcggtgatccaggaa
cacgaaaatctcaaccaagacatcaaaattgccaacgaagaaatcctatcgagcaacgag
gagttgcaaagcaccaacgaagagttagaaactgccaaagaagagattcaagccactaac
gaggaactcactaccactaacgaggaacttcgcagccgcaatattgaacaaagcctggta
aataacgatctgataaatttgctttccagtatcaatatccctatcttaatgttgaccaac
gatttacagattcgacgctttaccccaacggcacagcaaatttttagtgtgattcccaca
gatgttggacgaccttttagcgacatccgctcaactctgaacgttcctggcttggaacag
atgattttggaggtgattgatactctccagacgaaagaacaagaaattcaaactttatcg
ggatattggtacaacctccgcattcgtccttaccggacaacggaaaaccagattgacggt
gtggtgatggttttgctcgatattgatgctcttaaacgcagtgccagaaccttggaggag
gcccgaaattatgctgaaaccattgtggaaactgtgcaaacgcctttagtcgcgctagat
gctaatttccgagtgaataaagcaaatcgagcgttctatgaaacgtttcagatttcatcc
tcagaaacagcgcaatcttcgctgtttgagctaggaaacgggcagtggaatatccctcaa
ttgcgatggatattggaagatattctagttagtgatgttcagcttgaaaactttgagttg
actcacctgtttgagaagatcgggcagaaaactatgctgctgaatgcttgtaaacttcaa
cgagaagaccaagctttaatgattctgttgtcgatcgaggatatcacggagcgcaagcag
tttgagaaagtacgatcgcagttatttgagcacgaacagttggcccgccaacaagcagaa
acggccaaccgtgctaaagatgaatttctggcgaatctctcccacgaattacgcaatcct
ttgactccgatcctgggctggtcacaaattctgcgttccgggaaactgaagggagtagca
gttactaaggctttagaggtgatcgatcgcagcgcgagggcgcaatctcagttaatcgaa
gatatcctggatatttcccggattaccagcggcaagcttcaactgtgcatttgtccgatc
gatctgcggttagtggtgcaagctgcggtggagggggtgcaattatcagccgaggcaaaa
aacattcaaattgtttcggagttgatttctacgagtgttttaggggatatcaatcgcttg
cagcaagttgtgtggaatcttctgtctaatgcgattaagtttactccggcggggggacga
gtggaaatcctgctatcggcgatcgataatcatgctcaacttcgagtcagcgatacggga
aaaggcattgaggcacaatttttgccgtatattttcgatcgtttccatcaaggcgattcc
agcagcgttaaggcaaatcaagggctgggattgggtttatctatcgtgcgtcacctggtt
gaattgcacgggggaacggtgcaagccgaaagtccgggtgagggacaaggaactacaatg
actgtgagattgccgttgcgatcgctgcctcaagagttgacatcggcgatcgatttaaag
tcaactgctttggcagggcctttaaacgcctctagcgatcgcgtcccctctctcgaaggc
ttgcacatcttagccgtagacgatcagatcgatacgcgcgatttcttacaatttgtgctt
gaaggctatggggcggaggttttggcagttgcatctgccagaagtgcgatcgctgctttg
actgaaaatcccggcagatatgatgtgctcatctccgatctgggaatgccagaggaagat
gggtttttcttaattcgagaagtgcgagctcttgctgcggaagccggaggagaaatcccc
gccgcggcgctgactgcctatgcggggaataaagaacgcgaaatggctatcgaagctggt
tttcaaaggcatatggttaagccgatcgagccggttgtactaggattaatggtggctaat
ttagtaggacgattttaa

DBGET integrated database retrieval system