KEGG   Oscillatoria nigro-viridis: Osc7112_1001Help
Entry
Osc7112_1001      CDS       T02375                                 

Definition
Asparagine synthase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Osc7112_1001
Enzymes [BR:oni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Osc7112_1001
Peptidases [BR:oni01002]
 Cysteine Peptidases
  Family C44
   Osc7112_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1157815..1159527)
Genome map
AA seq 570 aa AA seqDB search
MGILPVHKKLNKSMENQKLINPNWVIAWGPEARSHPATWQTSGFAIIGAEPTFSRDRRFV
IVGDCCFDRTPILKQQIDTDGLTDLAIAARLWEQSGPQTLSLLSGQFALAVWDRDEQTLC
LGRDRVGAKTLYYTRTGTTRFLAPRLRSLNPYHDRELDLVALRDYLCCAFVPGSQTLWEA
VRELRPGSYLYLPDVEAQRYWQPQEQITNADRPLEWHSQQVRSLLEQLVQSALPAGKPVA
AYLSGGIDSSCVTAIATRLHDRPVHTFSMHFGAQYPSEIEFANIVAPHCGTEHHVLEVSP
QQIWELLPETLVAMDDPVGEGLTVPNLLLGRSAKQFADVVLNGEGGDPCFGGPKNKPMLL
NSLYGSIQGKPDPIAAYLTSFQKCYVDLPRLLKPEVWEKVKNAPSVFAEELQQTETTFLN
RLMRLNIEFKGADYILTKVNNLTAAAGLKARSPLFDSRMVALSLQIPPEYKLSGAQEKAV
LKAAVADLLPDAIVNRPKSGMVMSMQQWFLRDWQRQARSLLLNRHAAIGPYLDRSLIREW
LNYRGEVFPRYGLKLWLLVTLEIWLQVNRR
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcctgcccgtccataaaaagcttaataaatcaatggaaaatcagaagttgatt
aacccgaattgggtcattgcttggggcccagaagcccgatcgcaccctgcaacttggcaa
acttccggttttgccataatcggagcggaacccaccttcagccgcgatcggcgatttgtg
atcgtaggtgactgctgcttcgatcgcactccaatcctcaaacaacagattgacacggat
ggattgactgatttggcgatcgccgcgcggctatgggaacagtcaggccctcaaactttg
agcttactgtcaggacaatttgcccttgccgtgtgggatagagacgagcaaaccttgtgt
ctggggcgcgatcgcgttggagccaaaaccctctattacacccgtacaggaacgactcgc
tttctggcgcctcgactgcgatcgctcaatccgtatcacgatcgagaacttgatttagtt
gctttgcgcgactacttgtgctgtgcctttgtacccggatcgcaaacgctgtgggaagcg
gtgcgagagttgcggcccggtagctacctgtatttaccggatgttgaggcgcagagatac
tggcagccacaggagcaaattactaatgccgatcgccctttggaatggcacagtcagcag
gtgcgatcgcttttggaacaactcgtgcagtcagcgctaccagcgggaaaaccagtcgca
gcatacctttccggtggtattgattcaagttgcgtcacggcgatcgccacaaggctgcac
gatcgtccggtacacactttttcgatgcactttggcgctcaatatcccagcgagattgaa
tttgccaacatcgttgcgccacattgcggcactgagcaccacgttttggaagtttcgccg
cagcaaatttgggagttgctgccggaaacgctggtggcgatggacgatccggtgggggaa
ggcttgacggttcctaatttgctgctggggcgatcggcaaagcaattcgcagacgtggta
ctcaatggcgaaggcggcgatccgtgctttggcgggccgaaaaataagccgatgttactc
aacagtttgtacggttcgattcagggtaaaccagatccgatcgcagcttacttgacttcg
tttcaaaaatgctatgtggatttgccgcgtttgctgaagccggaggtttgggaaaaggtg
aagaatgcgccttccgtctttgctgaggaattgcaacagacagaaacgacgtttttgaat
cggctgatgcggctcaacattgagtttaaaggagccgattacattttaaccaaggtgaat
aatctcacggctgcggcgggactaaaagctcgatcgcccctgttcgattcgcggatggtg
gcactgagtttgcaaattcccccagagtacaagctttcgggcgcgcaggaaaaagcggtt
ctcaaagctgctgtggccgatttgctgcccgatgcgattgtcaaccgtccgaaaagcggc
atggtgatgtcgatgcagcagtggtttttgagggattggcagcggcaagcgcgatcgttg
ttgctgaatcgtcatgcggcgatcgggccttacctcgatcgatcgctaatccgcgagtgg
ctaaactatcgtggggaagtttttccccgctatgggctgaagctgtggctgctggtgacg
ctggaaatttggttacaagtgaatcgccgttag

DBGET integrated database retrieval system