KEGG   Oscillatoria nigro-viridis: Osc7112_1001Help
Entry
Osc7112_1001      CDS       T02375                                 

Definition
(GenBank) Asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00250  Alanine, aspartate and glutamate metabolism
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Osc7112_1001
Enzymes [BR:oni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Osc7112_1001
Peptidases [BR:oni01002]
 Cysteine Peptidases
  Family C44
   Osc7112_1001
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase Methyltransf_11
Motif
Other DBs
NCBI-ProteinID: AFZ05560
UniProt: K9VEC0
Position
complement(1157815..1159527)
Genome map
AA seq 570 aa AA seqDB search
MGILPVHKKLNKSMENQKLINPNWVIAWGPEARSHPATWQTSGFAIIGAEPTFSRDRRFV
IVGDCCFDRTPILKQQIDTDGLTDLAIAARLWEQSGPQTLSLLSGQFALAVWDRDEQTLC
LGRDRVGAKTLYYTRTGTTRFLAPRLRSLNPYHDRELDLVALRDYLCCAFVPGSQTLWEA
VRELRPGSYLYLPDVEAQRYWQPQEQITNADRPLEWHSQQVRSLLEQLVQSALPAGKPVA
AYLSGGIDSSCVTAIATRLHDRPVHTFSMHFGAQYPSEIEFANIVAPHCGTEHHVLEVSP
QQIWELLPETLVAMDDPVGEGLTVPNLLLGRSAKQFADVVLNGEGGDPCFGGPKNKPMLL
NSLYGSIQGKPDPIAAYLTSFQKCYVDLPRLLKPEVWEKVKNAPSVFAEELQQTETTFLN
RLMRLNIEFKGADYILTKVNNLTAAAGLKARSPLFDSRMVALSLQIPPEYKLSGAQEKAV
LKAAVADLLPDAIVNRPKSGMVMSMQQWFLRDWQRQARSLLLNRHAAIGPYLDRSLIREW
LNYRGEVFPRYGLKLWLLVTLEIWLQVNRR
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgggcatcctgcccgtccataaaaagcttaataaatcaatggaaaatcagaagttgatt
aacccgaattgggtcattgcttggggcccagaagcccgatcgcaccctgcaacttggcaa
acttccggttttgccataatcggagcggaacccaccttcagccgcgatcggcgatttgtg
atcgtaggtgactgctgcttcgatcgcactccaatcctcaaacaacagattgacacggat
ggattgactgatttggcgatcgccgcgcggctatgggaacagtcaggccctcaaactttg
agcttactgtcaggacaatttgcccttgccgtgtgggatagagacgagcaaaccttgtgt
ctggggcgcgatcgcgttggagccaaaaccctctattacacccgtacaggaacgactcgc
tttctggcgcctcgactgcgatcgctcaatccgtatcacgatcgagaacttgatttagtt
gctttgcgcgactacttgtgctgtgcctttgtacccggatcgcaaacgctgtgggaagcg
gtgcgagagttgcggcccggtagctacctgtatttaccggatgttgaggcgcagagatac
tggcagccacaggagcaaattactaatgccgatcgccctttggaatggcacagtcagcag
gtgcgatcgcttttggaacaactcgtgcagtcagcgctaccagcgggaaaaccagtcgca
gcatacctttccggtggtattgattcaagttgcgtcacggcgatcgccacaaggctgcac
gatcgtccggtacacactttttcgatgcactttggcgctcaatatcccagcgagattgaa
tttgccaacatcgttgcgccacattgcggcactgagcaccacgttttggaagtttcgccg
cagcaaatttgggagttgctgccggaaacgctggtggcgatggacgatccggtgggggaa
ggcttgacggttcctaatttgctgctggggcgatcggcaaagcaattcgcagacgtggta
ctcaatggcgaaggcggcgatccgtgctttggcgggccgaaaaataagccgatgttactc
aacagtttgtacggttcgattcagggtaaaccagatccgatcgcagcttacttgacttcg
tttcaaaaatgctatgtggatttgccgcgtttgctgaagccggaggtttgggaaaaggtg
aagaatgcgccttccgtctttgctgaggaattgcaacagacagaaacgacgtttttgaat
cggctgatgcggctcaacattgagtttaaaggagccgattacattttaaccaaggtgaat
aatctcacggctgcggcgggactaaaagctcgatcgcccctgttcgattcgcggatggtg
gcactgagtttgcaaattcccccagagtacaagctttcgggcgcgcaggaaaaagcggtt
ctcaaagctgctgtggccgatttgctgcccgatgcgattgtcaaccgtccgaaaagcggc
atggtgatgtcgatgcagcagtggtttttgagggattggcagcggcaagcgcgatcgttg
ttgctgaatcgtcatgcggcgatcgggccttacctcgatcgatcgctaatccgcgagtgg
ctaaactatcgtggggaagtttttccccgctatgggctgaagctgtggctgctggtgacg
ctggaaatttggttacaagtgaatcgccgttag

DBGET integrated database retrieval system