KEGG   Oscillatoria nigro-viridis: Osc7112_1908Help
Entry
Osc7112_1908      CDS       T02375                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:oni00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Osc7112_1908
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Osc7112_1908
Enzymes [BR:oni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Osc7112_1908
Two-component system [BR:oni02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Osc7112_1908
Bacterial motility proteins [BR:oni02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Osc7112_1908
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205680..2206765
Genome map
AA seq 361 aa AA seqDB search
MLSPIKLLLVEDSPVVTLVLKRIFESSPEIQVVGTACNGLEGLELIPKLQPQVICTDLNM
APMNGLEFTEEVMKKYPLPILVISASVQANDTQNVFQLLKAGALDVFPKPIGGLVSDYAH
LATQLIAKVKILSGVKVFTRHPKKTPTEDNNQIVKINQAPVPNYKFSNENVKAQTIKVLA
IGASTGGPQALYAIISKLPASFPVPIICVQHISEGFLQGLVDWLGYESKLPVKIASFGEL
PQAGTVYFPPEKRHLELDSQGRFVYSEAAHVAGHCPSVTVTFKSVANFYSRAAAGVLLTG
MGRDGADGMLAIARQGGLTIAQDEASCIVFGMPKEAIALGAAQYVLPVSAIAPLLLAKLK
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgcccattaaactattgttagttgaagattccccagtagttacgctcgtcctc
aaacgaatttttgagtcctcgccagaaatccaagttgtaggaaccgcttgcaacggatta
gaaggactagaattaatccccaaacttcagccccaagtaatctgtacggatttgaacatg
gcaccaatgaacgggttagaatttaccgaagaagtaatgaagaaatatccgctaccaatt
ttagtaattagtgcttcagtgcaagcgaatgatactcagaatgtatttcaattgttaaag
gctggtgcattggatgtttttccgaaaccgattggcgggttggtatctgattacgctcac
ctagcaactcaattaatagctaaagttaaaatactctcaggagtcaaagtatttacacgg
catccaaaaaagacgccaacagaagataataatcaaattgtaaaaatcaaccaagcacca
gttcctaattacaaattttccaacgaaaatgttaaagctcaaactattaaagtattggct
ataggggcttctacaggcgggccacaagcactgtacgcgattatttctaaacttccggct
agttttcccgtgcctataatttgtgtccagcacatcagtgaaggttttttgcaaggatta
gttgattggctgggttatgaatctaaactgcctgttaagatagcttcttttggggaattg
ccacaagcagggactgtttatttcccgccagaaaaacgtcatttagaattggactctcaa
ggcagatttgtttattcagaagctgctcatgttgcgggacactgcccttctgtaacggtg
acatttaagtcggtagctaatttttatagtcgggcagcagcgggggttttgctgacagga
atgggtagagatggtgctgacggaatgttggctattgcgagacaaggggggttgacaatc
gcccaagacgaagctagctgcattgtcttcggaatgcccaaggaggcgatcgccctcggt
gccgcccaatatgttctacctgtcagtgcgatcgctcccctactcctggcaaaattaaaa
atttag

DBGET integrated database retrieval system