KEGG   Oscillatoria nigro-viridis: Osc7112_1908Help
Entry
Osc7112_1908      CDS       T02375                                 

Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:oni02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:oni02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2205680..2206765
Genome map
AA seq 361 aa AA seqDB search
MLSPIKLLLVEDSPVVTLVLKRIFESSPEIQVVGTACNGLEGLELIPKLQPQVICTDLNM
APMNGLEFTEEVMKKYPLPILVISASVQANDTQNVFQLLKAGALDVFPKPIGGLVSDYAH
LATQLIAKVKILSGVKVFTRHPKKTPTEDNNQIVKINQAPVPNYKFSNENVKAQTIKVLA
IGASTGGPQALYAIISKLPASFPVPIICVQHISEGFLQGLVDWLGYESKLPVKIASFGEL
PQAGTVYFPPEKRHLELDSQGRFVYSEAAHVAGHCPSVTVTFKSVANFYSRAAAGVLLTG
MGRDGADGMLAIARQGGLTIAQDEASCIVFGMPKEAIALGAAQYVLPVSAIAPLLLAKLK
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgttatcgcccattaaactattgttagttgaagattccccagtagttacgctcgtcctc
aaacgaatttttgagtcctcgccagaaatccaagttgtaggaaccgcttgcaacggatta
gaaggactagaattaatccccaaacttcagccccaagtaatctgtacggatttgaacatg
gcaccaatgaacgggttagaatttaccgaagaagtaatgaagaaatatccgctaccaatt
ttagtaattagtgcttcagtgcaagcgaatgatactcagaatgtatttcaattgttaaag
gctggtgcattggatgtttttccgaaaccgattggcgggttggtatctgattacgctcac
ctagcaactcaattaatagctaaagttaaaatactctcaggagtcaaagtatttacacgg
catccaaaaaagacgccaacagaagataataatcaaattgtaaaaatcaaccaagcacca
gttcctaattacaaattttccaacgaaaatgttaaagctcaaactattaaagtattggct
ataggggcttctacaggcgggccacaagcactgtacgcgattatttctaaacttccggct
agttttcccgtgcctataatttgtgtccagcacatcagtgaaggttttttgcaaggatta
gttgattggctgggttatgaatctaaactgcctgttaagatagcttcttttggggaattg
ccacaagcagggactgtttatttcccgccagaaaaacgtcatttagaattggactctcaa
ggcagatttgtttattcagaagctgctcatgttgcgggacactgcccttctgtaacggtg
acatttaagtcggtagctaatttttatagtcgggcagcagcgggggttttgctgacagga
atgggtagagatggtgctgacggaatgttggctattgcgagacaaggggggttgacaatc
gcccaagacgaagctagctgcattgtcttcggaatgcccaaggaggcgatcgccctcggt
gccgcccaatatgttctacctgtcagtgcgatcgctcccctactcctggcaaaattaaaa
atttag

DBGET integrated database retrieval system