KEGG   Oscillatoria nigro-viridis: Osc7112_2027Help
Entry
Osc7112_2027      CDS       T02375                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Osc7112_2027
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Osc7112_2027
Enzymes [BR:oni01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Osc7112_2027
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2368135..2369115)
Genome map
AA seq 326 aa AA seqDB search
MTWTRRHILTLADFTSDEYDTVLQTAASFREVLGRRTKKVPALQGQVVANLFFEPSTRTR
NSFELAAKRLSADTLNFTPGSSSLTKGETILDTAKTYLAMGTDLMVIRHEQAGVPSTIAS
EMDRLGSRVSVLNAGDGQHEHPSQGLLDLFTICSLLDTERPRLELLAGKKIAVVGDILHS
RVARSNIWSLTASGAEVHLAGPPTLLPLLFAECGDGREGKLFLHWQLEPALADADFVMTL
RLQKERMSDHLLPSLREYHSLYGITRDRLKLCKPDVKVLHPGPVNRGVEISSDLMDDAQF
SLISQQVTSGVAVRMALLYLIGGGKV
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgacttggacaaggcgacacattctcactctggctgattttacctcggacgaatacgat
acggtgctgcaaacagcagccagttttcgggaggtgctcggccgccgcacgaagaaagtg
ccggccctgcagggtcaagtggtcgcgaatttgttttttgaaccttctacccggactcgc
aatagttttgagttggcggcgaagcggctgtcggctgacacgctgaattttactccggga
agttcttctctgacgaaaggggagactattctggatacggctaagacttatctggcgatg
ggaacggatttgatggtgatccggcacgaacaagctggagttcccagcacgattgcttcg
gaaatggatcgcttgggttcgagagtcagcgttctcaatgcaggagacggtcagcacgaa
cacccgtcgcaaggtttgctagacttatttactatttgttctctgttagataccgaacgt
ccgcggctggaactgttagcgggcaaaaaaattgctgtggtgggggatatcttgcattcg
cgggtggctaggtctaatatttggagtctaacggcttctggggcagaggttcatttggcc
gggccgccgactttgctaccgctgttgtttgctgagtgtggcgatggtagggaaggcaag
ttatttttgcactggcagcttgaacctgctttagccgatgctgattttgtgatgactttg
cggctgcaaaaggaacggatgagcgaccatttgctcccgagtttacgagagtaccattct
ttgtacgggattacgcgcgatcggctcaaactctgcaagccggatgtgaaggtgttgcac
ccgggcccggtcaaccgcggcgtggaaattagttcggatttgatggacgatgcccagttt
agcctgatatctcagcaagttaccagcggcgtggcggtgcggatggcattactttatctg
atcggcggcggtaaagtttag

DBGET integrated database retrieval system