KEGG   Oscillatoria nigro-viridis: Osc7112_2098Help
Entry
Osc7112_2098      CDS       T02375                                 

Definition
Glucosylceramidase (EC:3.2.1.45)
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    Osc7112_2098
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Osc7112_2098
Enzymes [BR:oni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     Osc7112_2098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2449069..2451498)
Genome map
AA seq 809 aa AA seqDB search
MNDRTSHPNIPPHAWKRPIGLGWENPYTVRYASNLDDGPWHGMPLGGFGAGCIGRSSRGD
FNLWHIDGGEHIFRSLPACQFSVFEETQGKKQAFALSTEPPTDGSLSSWKWYPSEGRRKK
EEGRREESTSGTYHALYPRSWFVYENVFQAQLSCEQFSPILPNNYQESSYPVAMFEWVAH
NPTDAPITLSIMLTWENIVGWFTNANKSPKVKVRDDGSPFYDYQPRWGESAGNLNLLVED
FHRIGCVMTRLTADDEPQEGDGQWAIATITNPAVEVFYQTRWNPAGNGDDIWRNFSAEGF
LLDDRDETAAAAGEQLACAIAVRFTIRPGKTRKIPFIIAWDLPVTEFASGVWYYRRYTDF
FGRNGKNAWPIIRTAMKHSDTWRENIEAWQKPILERQDLSDSFKMALFNELYALTDGGTL
WSAADERDPKGQFAVLECIDYRWYESLDVRLYGSFALLMLWPDLEKSVVLAFARAISAGD
DTPRIIGWNQASAIRKAVGATPHDLGAPNEHPWEKTNYTSYQDCNLWKDLPCDFVLQVYR
DFLLTGGTDCEFLQECWPAIVEALAYLKTFDEDGDGIPENSGAPDQTFDDWQMRGISAYC
GGLWLAALEAAIAIGEILEDAAPEIIPNPQAKIALYHSWLLQARPSYQEKLWNGQYYRLD
SESNSEVVMADQLCGQFYAKLLGLPDIVPPECAVSALETVYESCFLKFNDGEFGAANGVM
LNGSPENPNATHPLEVWTGINFGLAAFLVQMGMEEKAFKLTDAVVKQIYENGLQFRTPEA
ITAGGTFRASHYLRAMAIWAIYGVLTNFK
NT seq 2430 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatcgcacatcccatccaaacatccccccgcacgcctggaaacgtcccatcggc
ctcggttgggagaatccctatacagtccgctacgcaagcaatctcgacgacggtccctgg
cacggaatgcctctgggcgggttcggtgccggctgcatcgggcgatcgtcccgcggcgac
ttcaacctctggcacattgacggcggcgagcacatttttcgcagtttgcccgcttgtcag
ttcagcgtttttgaagaaactcaaggcaagaaacaagcttttgcactgtccactgaaccg
cctaccgatggcagtttatcgagttggaaatggtatccatcggaaggacgaaggaagaag
gaagaaggaagaagggaagagtcaacttcggggacttatcatgctttgtatccgcgcagt
tggtttgtttacgaaaatgtatttcaagctcaattaagctgcgagcaattttcgccaatt
ttgccgaacaattatcaggaaagcagttaccctgttgccatgtttgaatgggtggcgcac
aatcctacagatgcgccgattactctcagcatcatgctgacttgggagaatattgtcggt
tggtttactaatgccaataagtcgccgaaagtgaaggtgcgagatgatggcagtccattt
tatgactatcaaccccggtggggagaaagtgccggaaatttgaatttgttggtggaagat
tttcaccggatcggttgcgtgatgacgcggttgactgctgatgacgaaccgcaagagggg
gatggacaatgggcgatcgcaactattactaatccggcggtagaagtattctatcaaact
cgctggaacccggcggggaatggcgacgatatttggcgcaacttttctgctgaaggtttc
ttgttggatgacagagacgagacagctgcagcagccggagaacagttggcttgtgcgatc
gcagttcgctttactattcgaccgggaaaaactcgcaaaattccctttattatagcttgg
gatttgcccgttactgagtttgcatcgggagtttggtactaccgccgctatactgatttc
ttcggccgcaacggcaaaaatgcttggccgattattcgcactgcaatgaagcattccgat
acttggcgcgaaaatattgaagcttggcaaaaacctattttagaacggcaagatttgtca
gacagttttaaaatggcgctgtttaacgagttatacgccctgacagatggcggtactctt
tggagtgcggctgacgaacgcgatccgaagggtcaatttgcggttttggagtgcattgat
taccgctggtacgaaagtttggacgtgcggctttacggttcttttgctttgttgatgctg
tggccggatttggaaaagtcggtggttttagcgttcgctagggcaatttctgccggagac
gatacgccgagaattattggctggaatcaagcttctgctattagaaaagctgtcggggcg
acgccgcacgatttgggtgctcctaacgaacatccttgggagaaaaccaattatactagc
tatcaagattgcaatttgtggaaggatttgccttgcgattttgtgttgcaggtttatcgt
gactttttgttgactggcggcacagattgcgagtttctgcaagagtgttggccggcaatt
gttgaggctttggcttatctgaaaacttttgatgaggatggggacggaattccagagaat
tcgggagcaccggatcagacgtttgatgactggcaaatgcgggggataagtgcgtattgc
gggggtttgtggttggcggcgctggaggctgcgatcgcgatcggcgaaatcttggaagat
gcagcaccggagataattcctaaccctcaagcaaagatagcattatatcacagttggctg
ctacaagcaagaccgagctatcaagaaaaactgtggaacggtcaatattaccgtttggac
agcgagagtaattccgaagtggtgatggccgaccaactgtgcggtcaattttacgcgaaa
ctgttaggattaccggatattgtgccgccggaatgtgcagtcagtgctttagagactgtg
tacgaatcttgctttttgaagttcaacgatggcgagttcggtgcggcaaatggggtgatg
ctgaatggttcgccggaaaatcccaatgcgactcatcctttggaagtttggacggggatt
aattttgggttggctgcttttttggtacagatggggatggaggagaaagcgtttaaattg
acggatgcggtggtgaagcagatttatgaaaatgggttgcagtttcgcacgccggaagcg
attacggcgggggggacttttcgggcgagtcactatttgcgggcgatggcgatttgggcg
atttacggggtgttgacaaattttaaatag

DBGET integrated database retrieval system