KEGG   Oscillatoria nigro-viridis: Osc7112_2505Help
Entry
Osc7112_2505      CDS       T02375                                 

Definition
ROK family protein
Orthology
K00886  
polyphosphate glucokinase [EC:2.7.1.63]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Glycolysis / Gluconeogenesis
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:oni01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:oni00010]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:oni00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2931893..2932600)
Genome map
AA seq 235 aa AA seqDB search
MTEQDRSTRTLAVDIGGSGIKVMVLDNEGEPQTERSRLETPQPPKPEPVLEAIASLASGQ
GEFDRVSVGFPGVVCGGVIKTAVNLDPSWIDFDLQTTLKDRLGKPVRVANDADIQGLGAI
AGTGVELVITLGTGFGSALFVDGILVPNLELGHHPFRKGETYEQQLGRLALDTVGSKRWN
RRLEKALTYLQDIFNCDRIYIGGGNTKKIAVELPPQVKIVPNVSGLLGGIALWRD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgactgaacaagatcgatcgactcgcaccttagccgttgacattggcggaagcggcatc
aaagttatggtgttggacaatgaaggcgaaccccaaacggaacgcagccgtttagaaacg
cctcaaccaccgaaaccggaacccgtattagaggcgatcgcctctttagccagcggacaa
ggggaatttgaccgagtatccgtcggttttcccggcgtcgtctgtggcggcgtcatcaaa
accgcagtgaatttagatccgtcttggatagattttgacttacaaactactctcaaagat
cgcttgggaaaacctgtgcgagtagctaacgatgccgatattcaaggattgggagcaatt
gctgggacgggggtagaattagtaattacccttggcacgggtttcggttctgccttattt
gtcgatggtatcttggtgccaaatctagagttaggacatcacccgtttcgcaaaggggaa
acttacgaacagcaattaggtcgcttggcattagatacagtgggttccaaaagatggaat
cgccgcctggaaaaagcgctcacctatctgcaagatatctttaactgcgatcgcatttac
atcggcggcggtaatactaaaaagattgctgttgagttaccgccgcaggttaaaatagta
cccaatgtgagcggtttgttgggcgggattgctttgtggcgcgattga

DBGET integrated database retrieval system