KEGG   Oscillatoria nigro-viridis: Osc7112_3452Help
Entry
Osc7112_3452      CDS       T02375                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
oni  Oscillatoria nigro-viridis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:oni00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Osc7112_3452
DNA repair and recombination proteins [BR:oni03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Osc7112_3452
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4067657..4068250)
Genome map
AA seq 197 aa AA seqDB search
MYTRPLARLIEQLQRLPGVGPKTAQRLALHILKRPEEEVQALAKSLIDAKQQVGFCQVCF
HLSADPVCEICRNTNRDTHTICVVSESRDVIALEKTREYMGKYHVVGGVISPMDGIGPEQ
LNIQPLVRRVTQQKIKEVIIAISPSVEGETTTLYIGHLLKPFTLVTRIAFGLPMGGDLEY
ADEVTLARALEGRRELD
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgtacactcgacctttagctcgtttaatcgaacaattgcagcgcttgcccggagtcggc
ccaaaaacagcccagcggctcgctttacatattttgaagcgaccggaagaagaagtgcaa
gccctagctaaatctttgattgatgccaaacagcaagtaggtttctgtcaagtatgcttt
cacttatctgctgaccctgtttgcgaaatttgccgcaataccaaccgcgacactcatacc
atttgtgtagtgtcagaatcccgcgatgtaatcgctttagaaaaaacgcgggaatacatg
ggtaaatatcacgttgttggcggtgttatttcgccgatggatggaattgggccagaacaa
ttgaacattcaaccgttagtgcggcgcgtcacccagcaaaagattaaggaagtaattatt
gctattagtcccagcgtggaaggcgaaactactactctttatatcggtcacttattaaaa
ccttttacgctggtgacgcgcatagcttttggtttgccgatggggggagatttggaatat
gccgatgaagttacattggctcgcgctttggaaggaaggagggagttggattag

  All links  
No link information was found.   
DBGET integrated database retrieval system