KEGG   Oscillatoria nigro-viridis: Osc7112_3679Help
Entry
Osc7112_3679      CDS       T02375                                 

Definition
Succinate--CoA ligase (ADP-forming) (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Osc7112_3679
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Osc7112_3679
   00640 Propanoate metabolism
    Osc7112_3679
   00660 C5-Branched dibasic acid metabolism
    Osc7112_3679
Enzymes [BR:oni01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Osc7112_3679
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4345607..4346836
Genome map
AA seq 409 aa AA seqDB search
MDLLEYQAKSLFRQMAIPILPSQRIDNPADLKGLKIPYPVVLKSQVRAGGRGRAGGIKFV
ENTIDAVAAAQTIFNLPIEEEYPQVLLAEAKYNADQELYLAVLLDPVARRPVLLGSRQGG
MDVEGSIEQMQQVAVDQEFSPFYARRLTLKMGLQGDLIQSVSTIVEKMYRLFVEKDLDLV
EINPLGISPTGEVMALDGKVTANDDALGRHPDLAALSGKRQSSGLARERRSPYASGDRPH
SQSKVQQSPEFDPKSKSPISNSESLQLIELDGTIAILCNGVGLTMATLDAVTHQGGKPAN
FVNIGSLDRYYAANALRDRVDLGLELVAQDKSVKVILVNILGSASKTEEIIAAVAGYLER
KARANRHIQVVLRLVELDADAVKKRLGQLPVQLASTLDEAAAASVSSAK
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggatttgttagagtaccaagctaaatctttatttcgccagatggcaattccgattttg
ccgtcgcagcggattgacaatcccgccgacctcaaaggactgaaaattccttaccccgtt
gtactcaaatcgcaagtgcgggctgggggacggggcagggcgggcggtatcaagtttgtg
gaaaatacgatcgatgcagtagcagccgctcaaacaatttttaatttgccgatcgaggag
gaatatccccaagtcctgctggcagaagcaaagtacaacgccgaccaagaattgtactta
gcggtactcctagaccccgtagcgcgccgcccggtgcttctgggttcgagacaaggaggt
atggatgtcgaagggtcgatcgagcaaatgcagcaagttgccgtagatcaagaattttcc
ccattctacgcgaggcgtctcacgctgaaaatgggattgcagggagacttgattcaatcg
gtgagcaccattgtcgaaaaaatgtaccggctgtttgtcgaaaaagatttagatttagta
gaaatcaatcctctcggcatcagtccgacgggagaggtaatggctttagacggtaaagtc
accgccaacgacgatgccttggggcggcatccagatttggccgcactatcggggaagagg
caaagcagcgggttggcacgggaaagaagaagtccctatgcctctggcgatcgcccccat
tcccagtccaaggttcagcagtcgccggagtttgaccccaaatctaaatccccaatctcg
aattccgaatccctgcaattaatagaactagacgggactatcgcgattttgtgcaacgga
gtggggctgacaatggcaactctagatgctgtaactcaccaaggaggaaaaccagctaat
tttgtgaatattggttccctagaccgctactatgcagcaaatgccctgcgcgatcgcgtg
gatttgggtctggagttagtcgctcaggataaaagcgttaaggtgatacttgtaaatatt
ttgggcagcgcctccaagacggaggaaataatcgctgcagtagccggctatttggaacgg
aaagctcgcgctaaccgccacatccaggttgtgctgaggctggtagagctcgatgctgat
gctgttaaaaagcgtttgggacagttgccggtgcagctagctagcactttggatgaggcc
gcggccgcttctgtatcctccgccaagtag

DBGET integrated database retrieval system