KEGG   Oscillatoria nigro-viridis: Osc7112_3804Help
Entry
Osc7112_3804      CDS       T02375                                 

Definition
Stearoyl-CoA 9-desaturase (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:oni01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:oni01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4512050..4512865
Genome map
AA seq 271 aa AA seqDB search
MTIATQEKLQYNWKHVISLAGLHIGALFALLPSNFNWTAVGLTVFMHWITGGLGITLGWH
RLLTHRSFQTPKFVEYFLAFCGALACQGGIIDWVGLHRLHHTHSDESALDPHNAQKGFWW
SHIGWMLYKGPAHAEISRCTKDISSDPFYQFLQNYFLPMQIVFGVLLYLAAGWPFVVWVI
FVRLVLVYHCTWFVNSATHKFGYRTYETEDSSTNCWWVAVLTYGEGWHNNHHAFQYSARH
GMEWWEIDFTWMTIQVLEALGLATKVKLPAK
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgacaattgcaacgcaagaaaaactccaatacaattggaagcacgttattagtttagca
ggacttcatatcggcgctttgttcgccctgctaccaagtaacttcaactggacagcagtg
ggtttaacagtattcatgcactggataaccggcggtttgggaataactctcggatggcat
cgcctgctcacccaccgcagttttcagacaccaaaatttgtagaatattttctagcattt
tgcggagcccttgcctgtcaaggaggaataattgattgggttgggctgcaccgattgcac
cacacccactctgacgaaagcgccctcgaccctcacaatgcccaaaagggtttttggtgg
agtcatatcggctggatgctatataaaggtccagctcacgctgaaatttcccgctgtaca
aaagacatttcgagcgatccattttaccaatttttgcaaaactactttctcccgatgcaa
atcgtctttggtgtcttgctttacttagcagcaggctggccgtttgtagtgtgggtaatt
tttgtacgcttagttttggtatatcactgcacctggtttgttaacagcgccactcacaaa
tttggctaccgcacttacgaaaccgaagatagttctactaactgttggtgggtggctgtc
ttgacttacggcgaaggctggcacaacaaccaccacgcttttcaatactctgcgcgtcac
ggaatggaatggtgggaaattgacttcacttggatgacaattcaagttttggaagcacta
ggtttggctactaaggtgaaattaccagccaagtag

DBGET integrated database retrieval system