KEGG   Oscillatoria nigro-viridis: Osc7112_3882Help
Entry
Osc7112_3882      CDS       T02375                                 

Definition
(GenBank) L-threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00260  Glycine, serine and threonine metabolism
oni00750  Vitamin B6 metabolism
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
oni01120  Microbial metabolism in diverse environments
oni01230  Biosynthesis of amino acids
Module
oni_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Osc7112_3882
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Osc7112_3882
Enzymes [BR:oni01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Osc7112_3882
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP TPP_enzyme_N PK_C
Motif
Other DBs
NCBI-ProteinID: AFZ08222
UniProt: K9VL50
Position
complement(4588493..4589617)
Genome map
AA seq 374 aa AA seqDB search
MTLILPATDSAANSAARAAEPKRYGWPGLIEAYRPYLPVTETTPVVTLQEGNTPLIPAPA
IASVIGRDVRVLVKYDGLNPTGSFKDRGMTMAISKAKEAGAEAVICASTGNTSAAAAAYA
RRGGMRAFVLIPEGYVALGKLAQALLYGAEVISIGGNFDRALEIVREMAVNYPVTLVNSV
NPYRLEGQKTGAFEVVDALGDAPDWLCIPVGNAGNITAYWMGFCQYHQAKKCSRLPQMMG
FQAAGAAPLVTGSPVSHPETLATAIRIGNPASWKQAIAASEASRGSFAAVTDAEILDAYR
LLASQEGIFCEPASAASVAGLLKVKDQVPTGATVVCVLTGNGLKDPDTAINHSNNQFKSG
IAPSLDAVAGAMGF
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
gtgaccctgatcctacctgctactgactctgctgctaactccgctgcccgcgccgccgag
ccgaaacgctacggctggcccggcttgatcgaagcttatcgcccctacctgccggtgacg
gaaaccacgccggtagtgaccctccaagagggcaatactcccttgattccagcacctgcg
atcgcctctgttatcggtcgagacgtgcgcgtcttggtaaaatacgacggcctcaacccc
actggtagtttcaaagaccgggggatgacaatggcgatttccaaggcgaaggaagctggt
gccgaagctgtaatttgcgccagtaccggcaatacttcggccgccgccgccgcctacgcc
cgacgcggggggatgcgagctttcgtgttgattcccgaaggttacgtggctttgggcaag
ttggcgcaagctttgctttacggtgcggaagtaatttcgattgggggaaatttcgatcga
gccctagaaattgtccgcgaaatggctgtcaattatccggtgacattggtcaactccgtc
aatccttaccgcttggaaggccaaaaaaccggtgcttttgaagtcgttgacgccttgggc
gacgcccccgactggctgtgcattcccgtgggaaatgcgggaaacatcacagcatactgg
atgggtttttgtcaataccaccaagccaaaaaatgttcgcgcttgccgcagatgatggga
tttcaagccgccggggctgcaccgctggtaacgggctcaccggtatcgcacccagaaacc
ctggcgacggcgattcggatcggcaaccccgctagctggaaacaggcgatcgcagcttcc
gaagccagccgaggcagttttgcagcagtcaccgacgccgaaattctcgacgcttaccgt
ttgttagcatcgcaggaagggattttctgcgaaccggcgagtgcagcttcggtggccggc
ttgctgaaggtaaaagaccaagttccgacgggggcgacggtggtttgcgtgctaactggt
aacggtttgaaagacccggatacggcaattaatcacagcaacaatcaatttaaaagcggc
attgctccgagtttggatgcagtagctggggcgatgggattttaa

DBGET integrated database retrieval system