KEGG   Oscillatoria nigro-viridis: Osc7112_4138Help
Entry
Osc7112_4138      CDS       T02375                                 

Definition
1,4-alpha-glucan-branching enzyme (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Osc7112_4138
Enzymes [BR:oni01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Osc7112_4138
Exosome [BR:oni04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Osc7112_4138
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4900707..4903001)
Genome map
AA seq 764 aa AA seqDB search
MPATVPFEQIDRIVWNQHHDPFEVLGPHAIEENGKKVWAVRAYLPNADAVSVVLPEARAE
YAMKSEHHPHFFECTIDTPELANYQLRVKEGEHERFIYDPYAFRSPKLTEFDQHLFSEGN
HHRIYEKLGAHLTEVGGITGVYFAVWAPNARNVSVLGDFNYWDGRKHQMRKSQNGIWELF
IPGLSVGTSYKYEVKNQDGHPYEKSDPYGFQQEVRPKTASIVTDLDTYTWHDSAWIDKRR
HTDPLTQPISVYECHIGSWLHAATDEPAVLPNGEIEPPVQVSELNPGARFLTYRELADRL
IPYVKDLGFTHIEMLPIAEHPFDGSWGYQVTGYFAPTSRYGKPEDFMYFVDQCHANGIGV
LVDWVPGHFPKDGHGLAFFDGTHLYEHADSRKGEHKEWGTLVFNYGRNEVRNFLVSNALF
WFDKYHIDGIRVDAVASMLYLDYCREPGEWLTNQYGGRENIEAADFLRQANHVIFSYFPG
ALSIAEESTSWPMVSWPTYVGGLGFNLKWNMGWMHDMLDYYHMDPWFRQFHQNNVTFSMW
YNHSENFMLALSHDEVVHGKAHIIGKMPGDEWQKFANVRCLFTFMFAHPGKKTIFMGMEF
GQWQEWNVWGDLEWRLLQFEPHQKLKLFFKDLNNLYRSETALYSQDFAEDGFEWIDCSDN
RHSVVAFVRREKDGDEFVVTVCNFTPQPHSHYRVGVPEPGFYTELFNSDAREYGGSNMGN
LGGKWTDEWWFHNSAYSIDLCLPPLGVLILKLDRAKTTAKSQEF
NT seq 2295 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgaccgtcccctttgaacagattgaccgaattgtttggaatcagcaccacgat
ccatttgaagtgctaggccctcacgcgatcgaagaaaatggcaaaaaagtctgggccgtc
cgagcttatctgccgaatgcggatgcggtatcagtagttttgccggaggccagggccgaa
tacgcgatgaaatcagagcatcaccctcacttttttgaatgtacgatcgacaccccagaa
ctagcaaactatcaattgcgggtcaaagaaggggaacacgagcgcttcatctacgatccc
tacgcctttcgatcgcccaaactcacagaattcgaccagcacctattttcagaaggcaat
caccaccgcatttatgaaaaactcggggcgcacctcaccgaggtaggcggcatcacagga
gtatattttgccgtttgggctccgaatgcccgaaatgtgtcagttttaggagatttcaac
tattgggacggccgcaaacatcaaatgcggaaatcgcaaaacggcatctgggaattattt
attccgggactatccgtgggaacttcctacaaatacgaagtgaaaaaccaagacggacat
ccctacgaaaagtccgatccttacggtttccagcaagaagtgcggccgaaaacagcatca
attgtcaccgacttagacacctacacttggcacgacagcgcttggatcgataagcggcgg
cacacggacccactgacgcagccgatttccgtttacgaatgccacatcggttcttggctg
cacgccgctactgacgaacccgccgtgctaccaaatggggaaatagaaccccccgtgcag
gtttcggaactcaatcccggggcgcgctttctgacttaccgggaattagccgatcggctg
ataccctacgtcaaagatttgggattcactcacatcgaaatgctgccgatcgccgaacat
cctttcgacggttcttggggctatcaagtaaccggctatttcgccccaacttcccgctac
ggcaaacctgaagatttcatgtattttgttgaccagtgccacgccaacggcattggcgta
ctggtggactgggtaccgggacatttccccaaagacggccacggcttggctttctttgac
ggaactcacttgtacgaacacgccgactcccgcaagggcgaacacaaagagtggggaacc
ctagtatttaactacggccgcaacgaagtgcggaatttcctagtatcaaacgctctgttc
tggtttgacaagtaccacatcgacgggattcgcgtagatgccgtagcctcgatgctttat
ttggattactgccgcgaacccggagaatggctgaccaaccagtacgggggccgggaaaat
atcgaggctgctgattttctgcgtcaggcgaatcacgtcatttttagctatttcccaggt
gcgctgtcgatcgccgaagaatctacctcttggccgatggtatcttggccgacctatgta
gggggtttgggcttcaacctgaagtggaacatgggttggatgcacgatatgctcgactat
taccacatggacccgtggttccgccagttccaccagaacaacgtaactttcagtatgtgg
tacaaccacagcgagaatttcatgctggctttgtcccacgatgaggtagtccacggcaaa
gcccacatcatcgggaaaatgccaggggacgaatggcaaaagtttgcaaacgtgcggtgt
ttgtttacttttatgtttgctcatcccggaaagaaaacgatctttatggggatggagttc
ggccagtggcaagagtggaacgtttggggagatttggagtggcgtttgctgcaattcgag
ccgcatcaaaagttgaagctgttttttaaggatttgaacaatctgtaccgcagcgaaacg
gcactttacagtcaagattttgctgaggatgggtttgagtggattgattgcagcgacaac
cggcacagtgtcgtggcctttgtgcgccgagagaaggatggcgacgagtttgtggtgacg
gtgtgcaattttacgccccagccgcactctcactatcgcgtaggagtgccggaacccggt
ttctatacggagttgtttaacagcgacgcgcgggaatacggcggtagcaatatggggaat
ttggggggcaagtggactgatgagtggtggttccacaacagtgcttattcgatcgacttg
tgtttgccacctttgggggtgttgattttaaagctcgatcgggcaaaaacaacagcaaaa
tctcaagagttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system