KEGG   Oscillatoria nigro-viridis: Osc7112_4355Help
Entry
Osc7112_4355      CDS       T02375                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Osc7112_4355
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Osc7112_4355
Enzymes [BR:oni01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Osc7112_4355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5171524..5173074
Genome map
AA seq 516 aa AA seqDB search
MKLRELLAAVPSISFDAKHPALDAEVKGLSTNSHACQAGDLFLGMPGTRVDGGDFWQSAI
ESGAVAAIISTQAAEKTPPQPPLAKGGLEEVPSHLSKGLEEVPCVIAAADMAEVCGQIAT
AFYGTPASKLKLVGVTGTNGKTTTTHLIEFLLNEMQLPTAIFGTLYTRWPGFQKTALYTT
PFAVDLQKQLAEAVVAGCKHGVMEVSSHALAQQRVLGCSFEVAVFTNLTQDHLDYHRDME
DYFEAKSLLFGSDYLKNRAIINLDDPYGQRIVESLKSDRVWSYSTVLKTADLYAFDLQYQ
PNGVKGMLHTPKGETAFSLPLVGQFNLSNMLAAVGAVLELGLDLSAIVEKLSQFSGVPGR
MERVQISPDQDISVIVDYAHTPDSLENLLKASRPFIPGQMICVFGCGGDRDRTKRPIMGK
IVAELADLAVVTSDNPRTENPDRILDDILAGIPAAVKPIVMCDRAAAIRTAIMDAKPGDG
VLIAGKGHEDYQILGTEKVHFDDREQARDALKARMN
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgagagaattattagcagcagttcccagcatttcctttgacgccaaacatccc
gccctcgatgccgaagtcaagggtttatccactaattcccacgcttgtcaggcgggcgat
ttgtttttgggaatgccgggaactcgggttgatgggggagatttttggcaaagtgcgatc
gaatctggtgcagttgccgcgataatttccacccaagcagccgagaagacacccccccaa
cccccccttgctaagggggggctagaagaggttccttcccaccttagcaaggggctagaa
gaggttccctgcgtcatcgcagcagccgatatggctgaagtttgcggtcaaatagctact
gctttttacggcactccagctagcaaattaaaacttgtcggtgttaccgggactaacggc
aaaactacaacaactcatttaatcgaatttttgctcaatgaaatgcagttgccgacggcg
attttcggcacgctttatactcgctggccgggcttccaaaaaactgcactttacaccaca
ccttttgcggttgacctgcaaaagcaattagcagaagctgtagtcgccggatgcaaacac
ggcgtgatggaagtcagttcccacgctttagcgcagcagcgagttttggggtgtagtttt
gaagttgctgtgtttaccaacttgactcaagatcatctcgattatcaccgcgatatggaa
gattattttgaggcaaaatcgcttttatttggttcggattacctcaaaaatcgcgctatc
attaatcttgacgacccctacgggcagcggatagttgaaagtttaaagtccgaccgagtt
tggagttacagcactgttctgaaaaccgcagatttgtatgcttttgatttgcagtatcag
cccaatggagttaagggaatgcttcacactcccaagggcgaaactgctttttctttgcct
ttagtcggtcagttcaatttatcaaatatgttggctgctgtcggtgctgttttagaattg
ggtttggatttgtccgcaattgtggagaaattatctcagttttcaggtgttccgggacgg
atggaacgggtgcaaattagtcctgaccaagatattagcgttattgtcgattacgcgcac
actcccgacagtttggagaacttgttgaaggcgtcgcggccgtttattccgggtcagatg
atttgcgtgtttggctgcggcggcgatcgcgatcgcactaaacggccgatcatgggtaaa
atcgttgcagaattagccgatttagctgttgttacttccgacaatccgcgcacggaaaat
cccgatcgcattttggacgatattttagcaggaattcccgccgcagtaaagccgatcgtg
atgtgcgatcgagccgctgcaattcgcactgctattatggacgctaaacccggagatggc
gtgctgattgcagggaaaggacacgaagattatcaaattttgggcaccgaaaaagtccat
tttgacgatcgagaacaagcgcgagatgccttgaaagccagaatgaattag

DBGET integrated database retrieval system