KEGG   Oscillatoria nigro-viridis: Osc7112_4388Help
Entry
Osc7112_4388      CDS       T02375                                 

Definition
Glutathione S-transferase domain protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:oni00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5230167..5230775)
Genome map
AA seq 202 aa AA seqDB search
MIDLYTFTTPNGRKVSIMLEEIGLPYNVHVIDITKNDQFSPEFIAINPNSKIPAIVDRDN
GITVFESGAILIYLAEKSGRFLPADKQKYFQVIEWLMFQMASVGPMFGQLNHFKRFAPEQ
IPYAIGRYEKETLRLYGVLDTQLAKYEYICGDYSIADIATYPWVAIYEFQGLTLDNHPHL
KRWVETVQKRPAVERGMAVPSL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctatacacttttaccacaccgaacggtcgcaaagtctcgatcatgctcgaa
gaaataggtttaccctacaacgtgcacgtcatcgacatcacaaaaaacgaccaatttagc
ccagagttcatcgcaatcaaccccaacagcaaaattccggcgatagtcgatcgagataac
ggcatcaccgtcttcgagtccggcgctattctgatctatcttgccgaaaaaagcggcaga
tttctgcccgcagacaaacaaaaatactttcaagttatagagtggctgatgtttcaaatg
gccagcgtcggcccgatgtttggtcagctaaaccacttcaaacgctttgcacccgaacaa
attccctatgcgattgggcgctacgaaaaagaaaccttgcgcctctacggagtattagac
actcaactagcaaaatacgaatacatctgcggcgactattcgatcgccgacattgctacc
tatccctgggttgctatttacgaatttcaaggattaactctcgacaaccacccccacctc
aaacgttgggtagaaaccgtgcagaagcgtcccgccgttgagcgcggcatggctgttcca
tccttataa

DBGET integrated database retrieval system