KEGG   Oscillatoria nigro-viridis: Osc7112_4388Help
Entry
Osc7112_4388      CDS       T02375                                 

Definition
(GenBank) Glutathione S-transferase domain protein
  KO
K11209  
GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
oni  Oscillatoria nigro-viridis
Brite
Enzymes [BR:oni01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     Osc7112_4388
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(5230167..5230775)
Genome map
AA seq 202 aa AA seqDB search
MIDLYTFTTPNGRKVSIMLEEIGLPYNVHVIDITKNDQFSPEFIAINPNSKIPAIVDRDN
GITVFESGAILIYLAEKSGRFLPADKQKYFQVIEWLMFQMASVGPMFGQLNHFKRFAPEQ
IPYAIGRYEKETLRLYGVLDTQLAKYEYICGDYSIADIATYPWVAIYEFQGLTLDNHPHL
KRWVETVQKRPAVERGMAVPSL
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atgatcgatctatacacttttaccacaccgaacggtcgcaaagtctcgatcatgctcgaa
gaaataggtttaccctacaacgtgcacgtcatcgacatcacaaaaaacgaccaatttagc
ccagagttcatcgcaatcaaccccaacagcaaaattccggcgatagtcgatcgagataac
ggcatcaccgtcttcgagtccggcgctattctgatctatcttgccgaaaaaagcggcaga
tttctgcccgcagacaaacaaaaatactttcaagttatagagtggctgatgtttcaaatg
gccagcgtcggcccgatgtttggtcagctaaaccacttcaaacgctttgcacccgaacaa
attccctatgcgattgggcgctacgaaaaagaaaccttgcgcctctacggagtattagac
actcaactagcaaaatacgaatacatctgcggcgactattcgatcgccgacattgctacc
tatccctgggttgctatttacgaatttcaaggattaactctcgacaaccacccccacctc
aaacgttgggtagaaaccgtgcagaagcgtcccgccgttgagcgcggcatggctgttcca
tccttataa

DBGET integrated database retrieval system