KEGG   Oscillatoria nigro-viridis: Osc7112_4584Help
Entry
Osc7112_4584      CDS       T02375                                 

Definition
DNA-(apurinic or apyrimidinic site) lyase (EC:3.2.2.23 4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:oni00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Osc7112_4584
Enzymes [BR:oni01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Osc7112_4584
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Osc7112_4584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5491619..5492581
Genome map
AA seq 320 aa AA seqDB search
MPELPEVETICRGLNQATLDREMLGGDVLLNSTIARSISATDFLTQLKGKSIARWYRRGK
YLLAELSQFPEGERERGTGGQGESGRVGEFLAQTPISSQTPSFCPSLLPSKAGWLGVHLR
MTGQLLWVNRSEPLQKHARVRLFFEGNQELRFVDQRTFGQMWYVPAETEVSSTVTGLKLL
GPEPFSEEFTTEYLARKLHRRARPIKTALLDQSLIAGLGNIYADETLFLSGVMPTTLCAD
LTAEQIGRIHTAIIQVLQKAIASGGTTFSNFLNVQGVNGNYGGVAWVYNRAGQPCRTCSA
TIERIKLAGRSTHFCPICQT
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgccagagctgccagaagttgaaactatttgccggggtttgaatcaagcaaccctcgat
cgagaaatgttgggcggcgacgtgttgttaaacagcacgatcgcccgctcaatctctgcg
accgattttttgacacaactcaaaggaaagtcgatcgcccgctggtacagacgcggcaaa
tatctactggcagaactatctcaattcccagaaggagaaagagagagggggacaggggga
cagggggagagtgggagagtgggagaatttcttgcccaaactccaatctcttcccaaacg
ccttctttctgcccctcccttttgccttcaaaagccggctggttgggcgttcacctgcgg
atgaccggtcaactgctgtgggtgaaccgatccgaaccactgcaaaaacacgcgcgagtg
cggctgttttttgaaggaaaccaagaactgcggtttgtagaccagcgcactttcgggcaa
atgtggtacgtgcctgcagaaaccgaggtttccagcactgtcaccggtctgaaactctta
ggccccgaaccgttttcagaggaatttacaacagaatatttggcccgcaagctgcaccgg
cgggcgcgacccataaaaacagctttgctagaccagtcactgatagctggtttgggcaat
atttacgcagacgaaactttgtttttgtcgggagtgatgcccacaactctgtgcgcggat
ttgaccgcagagcaaattgggcgcatccatacagctattatccaagttttacagaaggcg
atcgcatccggcggcaccacttttagcaattttctcaacgtccaaggtgtcaacggcaac
tacggcggtgtcgcttgggtttacaatcgcgccggtcaaccctgccgcacttgctccgca
accatcgaacgtataaaattagcagggcgatcgactcatttttgccccatttgtcagaca
tag

DBGET integrated database retrieval system