KEGG   Oscillatoria nigro-viridis: Osc7112_4979Help
Entry
Osc7112_4979      CDS       T02375                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:oni00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5949413..5950000
Genome map
AA seq 195 aa AA seqDB search
METKFSSNLKTLGGNMAVLQLEDGRTYTDIRAIANQLAVLNIEIDSLPANKNPAFQELLV
QDILNVTEKQQILAAFNSEFEQFKRASGYQWCDLKVLHPGSQQIYALMTQSERTHTHTDA
EVLHILAGECVFGFVYSNGSQVQLMLQAEEYIKVPANTEHWFYLTPSLYLKALQYYTSAQ
GWVPQYTNRKLKIKN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaattttcctcaaatctcaaaacattaggtggtaatatggctgttctgcaa
ctagaagacggtagaacatatacggatatacgggcgatcgcgaatcaactggccgtttta
aatattgagatcgattccctgcccgcaaacaaaaatccggcgtttcaagaactgctagtt
caagacattctcaatgttacagaaaaacagcagattctcgcagcatttaatagcgagttt
gaacagtttaagcgcgccagcggatatcagtggtgcgacttaaaagttctgcatccaggt
tcgcagcagatttacgcgctgatgactcaaagcgagcgcactcacacccacacagatgca
gaagttcttcacattttagctggggaatgcgtttttgggtttgtgtattctaacggctct
caggtacaattaatgctgcaagctgaagaatacattaaagtgcctgccaataccgagcat
tggttttatctcactccgtcgctgtacttgaaagccttgcagtattacaccagtgctcaa
ggctgggttcctcagtatactaacaggaaactaaaaattaaaaactaa

DBGET integrated database retrieval system