KEGG   Oscillatoria nigro-viridis: Osc7112_4979Help
Entry
Osc7112_4979      CDS       T02375                                 

Definition
acireductone dioxygenase apoprotein (EC:1.13.11.54)
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Osc7112_4979
Enzymes [BR:oni01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     Osc7112_4979
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     Osc7112_4979
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5949413..5950000
Genome map
AA seq 195 aa AA seqDB search
METKFSSNLKTLGGNMAVLQLEDGRTYTDIRAIANQLAVLNIEIDSLPANKNPAFQELLV
QDILNVTEKQQILAAFNSEFEQFKRASGYQWCDLKVLHPGSQQIYALMTQSERTHTHTDA
EVLHILAGECVFGFVYSNGSQVQLMLQAEEYIKVPANTEHWFYLTPSLYLKALQYYTSAQ
GWVPQYTNRKLKIKN
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggaaactaaattttcctcaaatctcaaaacattaggtggtaatatggctgttctgcaa
ctagaagacggtagaacatatacggatatacgggcgatcgcgaatcaactggccgtttta
aatattgagatcgattccctgcccgcaaacaaaaatccggcgtttcaagaactgctagtt
caagacattctcaatgttacagaaaaacagcagattctcgcagcatttaatagcgagttt
gaacagtttaagcgcgccagcggatatcagtggtgcgacttaaaagttctgcatccaggt
tcgcagcagatttacgcgctgatgactcaaagcgagcgcactcacacccacacagatgca
gaagttcttcacattttagctggggaatgcgtttttgggtttgtgtattctaacggctct
caggtacaattaatgctgcaagctgaagaatacattaaagtgcctgccaataccgagcat
tggttttatctcactccgtcgctgtacttgaaagccttgcagtattacaccagtgctcaa
ggctgggttcctcagtatactaacaggaaactaaaaattaaaaactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system