KEGG   Oscillatoria nigro-viridis: Osc7112_5272Help
Entry
Osc7112_5272      CDS       T02375                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Osc7112_5272
Enzymes [BR:oni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Osc7112_5272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6307761..6308411
Genome map
AA seq 216 aa AA seqDB search
MTLSTRPELTSPNGIVSSITTQSQPAVSDEEMRQAVRTLLLGLGEDPDREGLRDTPKRVV
KALQFITEGYRQSLDELLNGAVFTENANEMVLVRDIDIFSSCEHHILPIIGKAHVAYIPN
GKVIGLSKIARICEMYGRRLQVQERLTAQIADALQGLLKPQGVAVVIEATHMCMVMRGVQ
KPGSWTATSAMRGVFTEDARTRQEFMSLIAHKSSFH
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgactttatctactcgtccagaactgacttctccaaatggtatagtgtcatcgattact
acccaatctcagcccgctgtctcagatgaagaaatgagacaagcagtgcgtacattgctg
ctaggattgggagaagacccagaccgtgaagggttacgagatacaccgaaacgagttgtc
aaagccttgcagtttataactgaaggttatcgtcaatctctcgacgaattgctcaacgga
gcagtattcacagaaaatgctaacgaaatggtgttagtgcgggacattgatattttcagt
tcctgcgaacatcacatcctgccaattattggcaaagcacacgttgcgtacatccccaac
ggcaaagtaattggactgtcaaaaattgctcgaatttgtgaaatgtacggccgcagattg
caagtacaagaacgcttaactgcacaaattgcggatgcacttcaaggattgctaaaacct
caaggtgtagcagttgtaattgaagcaactcatatgtgtatggtaatgcggggagtgcaa
aaaccaggttcttggactgcgacttcagcgatgcggggagtgtttactgaagatgccaga
actcgtcaagaatttatgagtttaatcgcgcacaaatcaagctttcactag

DBGET integrated database retrieval system