KEGG   Oscillatoria nigro-viridis: Osc7112_5389Help
Entry
Osc7112_5389      CDS       T02375                                 

Definition
acetaldehyde dehydrogenase (EC:1.2.1.10 1.1.1.1)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Osc7112_5389
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Osc7112_5389
   00620 Pyruvate metabolism
    Osc7112_5389
   00650 Butanoate metabolism
    Osc7112_5389
  Lipid metabolism
   00071 Fatty acid degradation
    Osc7112_5389
  Amino acid metabolism
   00350 Tyrosine metabolism
    Osc7112_5389
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Osc7112_5389
   00626 Naphthalene degradation
    Osc7112_5389
Enzymes [BR:oni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Osc7112_5389
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Osc7112_5389
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6436876..6439506
Genome map
AA seq 876 aa AA seqDB search
MKVTNVDELEVLIQKVKAAQAEFATYTQEQVDRIFKQAALAANAARIPLAKAAVKESGMG
VIEDKAIKNHFASEMIYNKYKNDKTCGIIESDRHFGYERIAEPVGVLAGIVPVTNPTSTT
IFKSLIVLKTRNGIIFSPHPRAKSCTAAAAKIILDAAVAAGAPPDIIGWIDEPTVPLSQA
LMQHPDIKLILATGGPGMVKAAYSSGHPSLGVGAGNTPAIIDETAHIQMAVSSILLSKTF
DNGTICASEQSVVVVDEVYDAVQLEFIKRGAYFLNAEEREKVRQVILIDGRLNAELVGQS
VQKVAEVAGFEVPSNIRVLIGEVEAVGKEEPLACEKLSPILAMYRAKDFTEAVDKAEALI
IFGGHGHTSVLYTAPHNQKHIRYFESKVETSRVLINTPSSQGAIGDLYNFRLDPSLTLGC
GSWGDNSISVNVTPHHLLNIKTVAERRENMLWFRIPPKIYFKSGCLPVALRDLAGKKRAL
IVTDKPLFELGLIKEVTDSLEEIGIDHYTFYDVEPDPSLATVRKGLQICNSFHPDVIIAF
GGGSPMDAAKVMWLMYEHPEIEFEGLAMRFMDIRKRVYELPPLGSKAIMVAIPTTSGTGS
EVTPFAVVTDEQSGIKYPLADYALTPSMAIVDPELTLNMPRKLTAYGGIDALTHALEAYV
SVLASEYTNGLALEAIRLLFKYLPSAYKNGASDPKAREKVHYAATIAGMAFANAFLGVCH
SIAHQLGATCHVPHGLANALMISHVIRYNATDVPFKQAIFSQNKYPNSKWRYARIADYLN
LGGDTEEEKVEKLIAAVEDLKRQVDIPSTIQEAIASQGMSDDFFFARVEEMADRAFDDQC
TGANPRYPLIEDLKQLLVQAYSHGDTSEVDRVLTVV
NT seq 2631 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaccaatgtagatgaattagaagtgctaattcaaaaagtaaaagcagcccaa
gctgaatttgctacctatactcaagaacaggtcgatcgcatattcaagcaagcagcttta
gccgctaatgccgcccgcattcccttagccaaggcagcagtcaaagaatcgggaatggga
gtcatcgaagataaggcaatcaaaaatcattttgcctcggaaatgatttacaacaaatac
aaaaacgacaagacttgcggtatcatcgagtccgaccggcattttggctacgaacgcatt
gccgaacccgtgggagtgctggcgggaatcgttcctgtaactaacccgacttccaccacc
atctttaagtctttaatcgtgctcaagacgagaaatggcattatattttcgccccatccc
cgcgccaaatcctgcacggctgcggcggcaaaaatcatcctcgatgctgctgtagcggca
ggagcaccaccggatattattgggtggattgacgagccaactgtgccgctttcccaagct
ttgatgcagcaccccgatatcaaactaattttggcaactggcgggccgggaatggtaaaa
gctgcctactcttcaggacacccatccctcggtgtcggcgcgggaaatactcccgccatc
attgatgaaaccgcccacatccaaatggctgtcagctcaattttgctcagcaaaactttc
gacaacggcacgatttgtgcttcggaacaatcggtggttgttgtggatgaggtgtacgat
gccgtgcaactggaatttatcaagcgcggtgcttatttcctcaatgcggaagaacgggaa
aaagtgcggcaggtaatcttaattgatggtcgattgaatgctgaacttgtcggacaatcc
gtgcaaaaggtggcggaggttgcgggttttgaagtgccgtcaaacatcagggttttgatt
ggagaagtggaggcggttggtaaagaagaacccttggcttgcgaaaaactttcgccgatt
ctcgccatgtaccgcgccaaggactttactgaagcagtagacaaagctgaagcgctgata
atttttggcggacacggacatacttctgtactctacacggctccgcacaatcagaagcac
attcgttattttgaaagcaaagtagagacttcgcgggtgctgattaataccccttcttct
caaggtgcgatcggcgatttgtacaatttccgcctcgatccctcccttaccctcggttgc
ggtagctggggcgataattctatttctgtcaacgtgacaccccatcacctgctgaatatc
aaaaccgtagcagaacgccgcgagaatatgctctggttccgcattcctcccaagatttat
tttaagtcgggttgtcttcctgtagctttgagggatcttgcaggtaagaaacgtgctttg
atcgtgacggataaaccattgtttgaattgggattgattaaggaagtcacagatagtttg
gaagaaatcggcatcgatcactacacattttacgatgtggaaccagatccttcgcttgct
actgttcgcaaaggtttacaaatctgcaatagtttccatccagatgtgattattgctttt
ggtggtggctcgccgatggatgctgctaaagtaatgtggctgatgtacgagcatccagaa
attgagtttgaaggattggcgatgcggtttatggatatccgcaagcgggtatacgaactg
ccgcctttgggatcgaaggcaattatggtggcaattccaactacttcgggaacgggttcg
gaagtcacgccttttgcggttgttacggatgaacaatcggggattaagtatccgcttgca
gattatgctctgactccgagtatggcgatcgtcgatccagaacttacgctgaatatgccc
cggaaactgactgcttacggcggcattgatgcgctaacccacgctttagaagcttatgtt
tctgtgttggcttctgagtatacaaatggtttggctttagaagcaattcgtttgctgttt
aaatacctgcccagcgcttacaaaaatggtgctagcgatccgaaagcgcgggagaaagta
cattatgctgctacgatcgccgggatggcatttgccaacgcttttctgggggtttgtcac
tcaattgctcaccaattaggtgcaacttgccacgtccctcacggtttagcgaatgcgctg
atgatttcccatgtaattcgctacaatgcaacggatgttccgttcaaacaagcgattttt
tctcaaaacaagtatcctaacagcaagtggcggtatgctcgaattgcggactatctgaat
ttgggcggcgatacagaagaggagaaagttgagaagttgatcgcagcggtggaagatctg
aagcgtcaggtagatattcctagcacgattcaggaggcgatcgccagtcagggaatgagc
gatgatttcttttttgctcgcgttgaggaaatggccgatcgcgcttttgacgatcagtgt
accggagcaaacccccgctacccgctgattgaagatttaaagcaacttctggtgcaagcg
tactctcacggcgacacttctgaggtcgatcgagtgttaactgtagtttaa

DBGET integrated database retrieval system