KEGG   Oscillatoria nigro-viridis: Osc7112_5477Help
Entry
Osc7112_5477      CDS       T02375                                 

Definition
CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:oni00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Osc7112_5477
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Osc7112_5477
Enzymes [BR:oni01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Osc7112_5477
Two-component system [BR:oni02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Osc7112_5477
Bacterial motility proteins [BR:oni02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Osc7112_5477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6528935..6529672
Genome map
AA seq 245 aa AA seqDB search
MKNTMNQLKVVINYTGELNKKNFEIVVVGTSLGGLEALTVLLADLPQSFPLPVVIVQHRH
KSSQNRLTDFLQKQSSLQITEAQDKEELAPGRVYLAPADYHLLIESPSEEEFSLYGNDFT
ESGSVAVESIHNSKVPIPNRGTPTFALSTEAPVCYARPSIDVLFESAADAFGEKVIGIIL
TGANSDGSKGLAKIKAEGGLTFVEEPASALCPIMPASAIANVEVDWILPLSKIAPCLVNL
LRIKD
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatactatgaaccaattgaaagtagtgataaactataccggagaattaaataaa
aaaaattttgaaatagtggtcgtgggcacgtctttgggagggctagaggctctgactgtg
ctgctggcagatttgccacaaagctttcctttgcctgtagttattgtccaacaccgccat
aagagttctcagaataggcttactgattttttacaaaagcaaagctctctccaaatcaca
gaggcccaagacaaagaggagctcgcacctggacgggtttacttggctcctgctgactat
cacttgctaatagaatcgccctctgaggaggagtttagcctgtatggaaacgactttaca
gaatcggggagtgtggcagtggagtcaatccataattcaaaagtcccaatccccaatcgc
ggaactcctacatttgcactatcaactgaggctcctgtctgctacgcgcggccctcaatc
gatgtgctgtttgagtctgctgcggatgcctttggggagaaagtgatcggcataatttta
acgggagctaattctgatggcagtaaagggctggcaaaaattaaagctgagggaggattg
acattcgtggaggaaccggcttcagctctatgcccgatcatgccagcgtcggcgatcgca
aatgttgaagtagactggattttacccctctctaaaatcgctccctgtttagtcaatttg
ctaagaattaaagattaa

DBGET integrated database retrieval system