KEGG   Oscillatoria nigro-viridis: Osc7112_5740Help
Entry
Osc7112_5740      CDS       T02375                                 

Definition
Histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Osc7112_5740
  Amino acid metabolism
   00340 Histidine metabolism
    Osc7112_5740
Enzymes [BR:oni01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Osc7112_5740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6873880..6875193)
Genome map
AA seq 437 aa AA seqDB search
MLRIITQWVEAQAELRRICDRTHDELVVHKEATVREVLQAVRRKGDQAVLHYTAEFDRIT
LNVEDVRVSGAELDAAYQQVSKELLNAIRTACKQVEAFHRQRVPKSWVQFGDDEIVLGKR
YTPVDRAGIYIPGGQASYPSSVIMNAIPAKVAKVPRLVMCTPPGQEKKMNPAVLVAAQEA
GVDEIYRVGGAQAIAALAYGTETIPKVDLITGPGNIYVTLAKKLVYGSVGIDSLAGPSEV
LIIADGSANPVHVAADMLAQAEHDSMASAILLTADSVLARKVVAEVDRQLANHPRRTLTE
KAIVNYGLVVVVDSLKAAAELSNEFAPEHLELQVADPWALLDQIRHAGAIFLGCSTPEAV
GDYLAGPNHTLPTSGAPRYASPLGVETFIKHSSLIQYSPAALKKVSRAINVLAEAEGLPS
HADSVRLRTENEGKGEF
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgctgcgaatcattactcagtgggttgaggcacaagctgaactgcgacggatctgcgat
cgcacccatgacgaacttgtcgttcacaaagaagccaccgtgcgggaggtgctgcaagct
gtaaggcgcaaaggcgatcaggctgtgctgcactacactgctgaatttgaccgcataacc
ctaaatgtggaagatgtacgggtgagtggcgccgaattggatgctgcttaccagcaggtg
tcgaaagaattattaaatgccatccgcacagcttgcaaacaggtagaggcgtttcaccga
cagcgcgtacccaaatcttgggtgcagtttggcgatgacgagattgttttgggcaagcgc
tacacgccggtcgatcgagcgggaatctacattcctggcggtcaggcgtcctatccgagc
tcggtgatcatgaatgcgattcctgcgaaggtcgccaaggtgccgagactggtgatgtgt
actccccccggacaagagaagaaaatgaatcctgcggtgctggtagcggctcaggaagcg
ggagttgatgagatttatcgggtcggcggggcgcaggcgatcgcggctttggcctacggt
acggaaactattccgaaggtggatttaattactgggccggggaatatttacgtcaccctg
gctaaaaaactggtttacgggagtgtggggatcgattctctggctggcccgtcggaagtg
ctgattattgccgatggttcggcgaatcctgtgcacgtggctgcggatatgttggctcaa
gctgagcacgattcgatggcgtcggcaattttgctgacggcggattcggtgctggctagg
aaggttgtggctgaagtagacagacagttggcaaatcacccgcgccgaactttaacagaa
aaggcgatcgtcaactatggtttagtcgtagtagttgactcgctcaaagcggcggcggaa
ctctctaacgagtttgcgcccgaacacttggaattgcaagttgcagatccctgggctttg
ctcgaccaaattcgccacgctggggcgattttcttgggctgctcgacgccggaagctgta
ggtgattatttggctggcccgaatcacactttgccgacttctggggctccgcgctatgcg
tcgccgctgggtgtcgaaacttttatcaagcattcgagtttgattcaatattcgcctgct
gcacttaagaaggtgagtagggcgattaatgttttagccgaagcagaggggcttccttct
cacgcggattcggtgcggctgcggactgaaaatgagggaaagggtgagttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system