KEGG   Oscillatoria nigro-viridis: Osc7112_5816Help
Entry
Osc7112_5816      CDS       T02375                                 

Definition
(GenBank) protoporphyrin IX magnesium-chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00860  Porphyrin and chlorophyll metabolism
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Osc7112_5816
Enzymes [BR:oni01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Osc7112_5816
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mg_chelatase AAA_5 AAA_22 MCM AAA_16 Sigma54_activat AAA_29 ABC_tran AAA MMR_HSR1 DUF815 AAA_18 AAA_27 AAA_28 AAA_30 AAA_7 RNA_helicase
Motif
Other DBs
NCBI-ProteinID: AFZ10024
UniProt: K9VR58
Position
complement(6963640..6964755)
Genome map
AA seq 371 aa AA seqDB search
MSPTAEVSNTLNAGALPTVTATAARRAVFPFTAIVGQEEMKLALLLNVIDPKIGGVMIMG
DRGTGKSTTIRALTDLLPEIEVVADDPFNSHPTDPDLMSDEVRDRTLSQTEIKIARKKVQ
MVDLPLGATEDRVCGTIDIEKALSEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLL
DSAASGWNTVEREGISIRHPAKFILIGSGNPEEGELRPQLLDRFGMHAEIRTVKDPNLRV
EIVEQRSSFDQNPVEFLAKYQHEQDEMQQKLVEAQERLKSVTIDRELRVKISQVCAELDV
DGLRGDLVTNRAAKAFTALECRTEVTVDDIRRVMTLCLRHRLRKDPLESIDSGYKVTKVF
DRVFGLETTEG
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcctactgccgaagtcagcaataccctaaatgcgggcgccctaccaaccgttacc
gctaccgcagcccgccgcgctgtttttcccttcactgcaattgttggccaggaggagatg
aaactggcgctgctgttgaatgtcatcgatcccaaaattggcggggtgatgattatgggc
gatcgaggtactggtaaatctaccacaatccgcgccctcactgatttgctgccggaaatt
gaggtggtggctgacgatccttttaacagtcatcccaccgatcctgatttgatgagcgat
gaggtgcgcgatcgcactttatctcaaactgagattaaaatcgcccgcaagaaagtccaa
atggtagatttacctttgggcgcgaccgaagaccgagtttgcggtacgatcgacatcgaa
aaagctttgtcggaaggtgttaaagcttttgaacccgggcttttagctaaagctaaccgc
ggcattctgtacgttgatgaagtcaatttgctcgacgatcatttagtcgatgtgttgctc
gactccgccgccagcggttggaatactgttgaaagagaaggcatttcgatccgccacccg
gctaagtttattttaatcggttccgggaacccagaagaaggagaattgcggccgcagttg
ctcgatagattcgggatgcacgcagaaattcggactgtaaaagacccgaatttaagagtg
gaaattgtcgaacagcgatcgagttttgaccaaaatccggtggagtttctcgcgaaatac
cagcacgaacaagatgagatgcagcagaagttggtggaagcccaggaaagattaaaatcg
gtaactatcgatcgagaattgcgggtaaaaatctcccaagtttgcgcggaattggacgta
gacgggctgcggggcgatttggtcacaaatcgggctgcgaaagctttcacggctttggaa
tgccgcacggaggtgactgtggacgatattcgccgggtgatgactctgtgtttgcggcac
cgattgcggaaagacccgctagaatcaatagattcggggtataaagtgaccaaagtgttc
gatcgggtattcggcctagaaacaactgaggggtaa

DBGET integrated database retrieval system