KEGG   Oscillatoria nigro-viridis: Osc7112_6078Help
Entry
Osc7112_6078      CDS       T02375                                 

Definition
(GenBank) Dihydrolipoyllysine-residue acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00010  Glycolysis / Gluconeogenesis
oni00020  Citrate cycle (TCA cycle)
oni00620  Pyruvate metabolism
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
oni01120  Microbial metabolism in diverse environments
oni01130  Biosynthesis of antibiotics
oni01200  Carbon metabolism
Module
oni_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Osc7112_6078
   00020 Citrate cycle (TCA cycle)
    Osc7112_6078
   00620 Pyruvate metabolism
    Osc7112_6078
Enzymes [BR:oni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Osc7112_6078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding AATase DEC-1_N ATP-grasp Aminotran_1_2 GCV_H
Motif
Other DBs
NCBI-ProteinID: AFZ10268
UniProt: K9VQA0
Position
7266108..7267403
Genome map
AA seq 431 aa AA seqDB search
MIREVFMPALSSTMTEGKIVSWVKSAGDKVEKGETVVVVESDKADMDVESFYEGYLAIII
VPAGEVAPVGAAIALVAETEAEIAVAQQQGAAAPTAAAAPAPSPAPVSAATSSAGLQQNV
SRQNGRSVVSPRARKLAKEFKVDLNSIKGSGPNGRIVAEDVEAAAGKAQPVPVQQQVTVP
AAPAPVPAAPAPAAAKPAPAPVPAIALSGQTVPMNALQNAVVRNMEASLSVPSFRVGYTI
TTDNLDKLYKQIKSKGVTMTGMLAKAVAVTLQKHPLLNACYVESGIQYRADINVAVAVAM
DGGGLITPVLQNADRLDIYSLSRTWKDLVDRARTKQLKPDEYSTGTFTLSNLGMFGVDKF
DAILPPNQGSILAIGSSRPQVVANEEGLMGVKRQMQVNITCDHRIIYGADAAAFLQDLAK
LLETNPQSLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgaagttttcatgccagccctgagttcgacaatgacagagggcaaaattgtt
tcctgggtcaaatccgccggagacaaagtagaaaaaggcgaaacggtggtagtcgttgaa
tccgacaaagccgacatggacgtggagtctttctacgaaggctatttagcaataattatc
gtacctgccggcgaagttgctccggtgggggcggcaatcgccctcgtagcagaaacagaa
gccgaaatcgccgtcgctcagcagcaaggagccgccgccccaaccgcagccgccgccccc
gctcccagccccgctcctgtcagcgcagctacatcgtcagcaggtttgcagcaaaatgtc
agccgccaaaacggccgcagcgtcgtttctccccgcgctcgcaagttagccaaagagttt
aaagtagatttgaattctatcaaaggcagcgggcccaacggtcgcattgtcgcagaggat
gtggaagcagcagccggcaaagcccaacccgttccggttcagcaacaggtaacagtcccc
gcagcacccgcaccagtccctgcggcacccgcccccgccgcagcaaaacccgcacccgca
ccagtcccggcgatcgcactttcgggccaaacagtaccgatgaacgcgctgcaaaatgcg
gtggtgcggaatatggaagcaagtttgagcgtgccgtctttccgcgtcggttacacaatt
actactgataatctggacaaactctacaaacaaattaagtccaagggcgtcacgatgacg
ggtatgctggcgaaggctgtagcagtaactttacaaaaacatcctctgctgaatgcttgt
tatgtggagtcgggaattcaataccgcgctgatattaatgtggcggtagcggtggcgatg
gacggcggcggtttgattacgccggtgctgcaaaatgccgatcgcctcgatatttattcg
ctctcgcgcacttggaaggatttagtcgatcgcgcccgcaccaagcagttgaagcctgat
gaatacagcacgggaacttttactctttccaatctgggaatgtttggagtagacaagttt
gacgcgattttgccgccgaatcaaggctcgattttggcgatcggctcttcgcggccgcaa
gtagtggcaaacgaggaaggtttgatgggagtgaagcgccaaatgcaggtgaatattact
tgcgatcaccggattatttacggtgctgacgctgcggcattcttgcaagatttagcaaaa
ttgcttgagacaaatcctcagtctttgacgctttag

DBGET integrated database retrieval system