KEGG   Oscillatoria nigro-viridis: Osc7112_6078Help
Entry
Osc7112_6078      CDS       T02375                                 

Definition
Dihydrolipoyllysine-residue acetyltransferase (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Osc7112_6078
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Osc7112_6078
   00020 Citrate cycle (TCA cycle)
    Osc7112_6078
   00620 Pyruvate metabolism
    Osc7112_6078
Enzymes [BR:oni01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Osc7112_6078
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7266108..7267403
Genome map
AA seq 431 aa AA seqDB search
MIREVFMPALSSTMTEGKIVSWVKSAGDKVEKGETVVVVESDKADMDVESFYEGYLAIII
VPAGEVAPVGAAIALVAETEAEIAVAQQQGAAAPTAAAAPAPSPAPVSAATSSAGLQQNV
SRQNGRSVVSPRARKLAKEFKVDLNSIKGSGPNGRIVAEDVEAAAGKAQPVPVQQQVTVP
AAPAPVPAAPAPAAAKPAPAPVPAIALSGQTVPMNALQNAVVRNMEASLSVPSFRVGYTI
TTDNLDKLYKQIKSKGVTMTGMLAKAVAVTLQKHPLLNACYVESGIQYRADINVAVAVAM
DGGGLITPVLQNADRLDIYSLSRTWKDLVDRARTKQLKPDEYSTGTFTLSNLGMFGVDKF
DAILPPNQGSILAIGSSRPQVVANEEGLMGVKRQMQVNITCDHRIIYGADAAAFLQDLAK
LLETNPQSLTL
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgattcgcgaagttttcatgccagccctgagttcgacaatgacagagggcaaaattgtt
tcctgggtcaaatccgccggagacaaagtagaaaaaggcgaaacggtggtagtcgttgaa
tccgacaaagccgacatggacgtggagtctttctacgaaggctatttagcaataattatc
gtacctgccggcgaagttgctccggtgggggcggcaatcgccctcgtagcagaaacagaa
gccgaaatcgccgtcgctcagcagcaaggagccgccgccccaaccgcagccgccgccccc
gctcccagccccgctcctgtcagcgcagctacatcgtcagcaggtttgcagcaaaatgtc
agccgccaaaacggccgcagcgtcgtttctccccgcgctcgcaagttagccaaagagttt
aaagtagatttgaattctatcaaaggcagcgggcccaacggtcgcattgtcgcagaggat
gtggaagcagcagccggcaaagcccaacccgttccggttcagcaacaggtaacagtcccc
gcagcacccgcaccagtccctgcggcacccgcccccgccgcagcaaaacccgcacccgca
ccagtcccggcgatcgcactttcgggccaaacagtaccgatgaacgcgctgcaaaatgcg
gtggtgcggaatatggaagcaagtttgagcgtgccgtctttccgcgtcggttacacaatt
actactgataatctggacaaactctacaaacaaattaagtccaagggcgtcacgatgacg
ggtatgctggcgaaggctgtagcagtaactttacaaaaacatcctctgctgaatgcttgt
tatgtggagtcgggaattcaataccgcgctgatattaatgtggcggtagcggtggcgatg
gacggcggcggtttgattacgccggtgctgcaaaatgccgatcgcctcgatatttattcg
ctctcgcgcacttggaaggatttagtcgatcgcgcccgcaccaagcagttgaagcctgat
gaatacagcacgggaacttttactctttccaatctgggaatgtttggagtagacaagttt
gacgcgattttgccgccgaatcaaggctcgattttggcgatcggctcttcgcggccgcaa
gtagtggcaaacgaggaaggtttgatgggagtgaagcgccaaatgcaggtgaatattact
tgcgatcaccggattatttacggtgctgacgctgcggcattcttgcaagatttagcaaaa
ttgcttgagacaaatcctcagtctttgacgctttag

DBGET integrated database retrieval system