KEGG   Oscillatoria nigro-viridis: Osc7112_6152Help
Entry
Osc7112_6152      CDS       T02375                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
oni  Oscillatoria nigro-viridis
Pathway
oni00400  Phenylalanine, tyrosine and tryptophan biosynthesis
oni01100  Metabolic pathways
oni01110  Biosynthesis of secondary metabolites
oni01130  Biosynthesis of antibiotics
oni01230  Biosynthesis of amino acids
Module
oni_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Osc7112_6152
Enzymes [BR:oni01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Osc7112_6152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS NanE FMN_dh His_biosynth IMPDH
Motif
Other DBs
NCBI-ProteinID: AFZ10338
UniProt: K9VQH1
Position
complement(7357576..7358475)
Genome map
AA seq 299 aa AA seqDB search
MLQIRRRPPSTSVSVLYLSYQIAVPDAAPQHILEEIVWEKEAEVAQKRDRTPLSELQKKL
PFAPPTRDFLAALKNGKTTPAIIAEVKKASPSKGVIREDFDPVAIALAYQQNGASCISVL
TDEKFFQGSFDNLAKIRAAVDLPLLCKEFIIYPYQIYLARIHGADAVLLIAAILSDKDLQ
YFVKIVKALGMTALIEVHTLEELDRVLTLEGVNLIGINNRNLADFSVSLETTSQLLASRH
TEIQAKGILTVSESGIHTPADLAKVASAGAQAVLIGESLVKQPDPGAALASLADRPPSL
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgcttcaaatccgccgccgtccccccagcacatcagtctccgtcctctacctcagctac
caaatcgccgtacccgacgccgcaccccagcacatcctcgaagaaattgtctgggaaaaa
gaagctgaagtagcccaaaagcgcgatcgcactcccttatccgaacttcagaaaaaactc
ccctttgcaccgccaactcgcgactttcttgccgcccttaaaaacggcaaaaccacaccc
gctatcatcgccgaagttaaaaaagcttcccccagcaaaggcgtaattcgcgaagatttc
gacccagtggcgatcgccctagcttaccaacaaaacggcgctagctgcatctccgtactt
accgatgaaaagttctttcaaggcagtttcgacaacctcgctaaaatccgtgccgccgtc
gatttacccttactttgcaaagagtttataatctatccctaccaaatttatcttgcccgc
attcacggcgctgatgctgtattgttaatcgcagctattctatctgacaaagacttacaa
tactttgtaaaaattgtcaaggctttggggatgacagctttaatcgaagttcacactctc
gaagaactcgatcgagtattaaccctagaaggcgttaacctgatcggcatcaacaaccgc
aacttagcagacttttccgtcagtttagaaaccaccagccaactattagcctcccgccac
accgaaatccaagcgaaaggcatcctcacagtcagcgagtcaggaatccacactcccgcc
gacctagctaaagttgccagcgccggagcccaggccgtcctcataggcgaatctctggtc
aagcagcccgatccgggtgcagctttagcctcgcttgccgatcgccctcccagcctgtga

DBGET integrated database retrieval system