KEGG   Oscillatoria nigro-viridis: Osc7112_6201Help
Entry
Osc7112_6201      CDS       T02375                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:oni00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Osc7112_6201
Enzymes [BR:oni01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Osc7112_6201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7413658..7414587
Genome map
AA seq 309 aa AA seqDB search
MPTIVSTAVVPFLGSEIVPDYDTAKVVILPIPYEATTTYRRGCENGPAKLLEASHQLECY
DEELDSEVCYDVGIYTKEPIADTRNRQPVSSSEMLQVTQAAVHQLVTENKFVISLGGEHS
ITAGVVEGYRQAYPNEPFTVVQIDAHGDLRHEYEGSIHNHACVMRRIVDMGLPTLQIGIR
AICKEEADLIKAKQLNVIRAREIATQPDWADRAIASITTKRVFLTIDLDGIDPTLIPGVG
TPEPGGLNWYSLTGFLRRIFESYEVIGCDIMELAPVVDSVVSEFTAAKLAYKMIGYQALA
QGWLKPDEE
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgccaacgatcgtttccactgcagtcgtaccgtttctggggtcggaaattgtaccagac
tacgacaccgccaaagtagtaatcttgccaattccctacgaagctaccaccacttaccgc
cgggggtgcgaaaacgggccggcgaaacttctagaagcttctcatcaactcgagtgctat
gacgaagaattggattccgaagtttgctacgatgtcggaatttatacaaaagagccgatc
gccgatacgcgcaacagacaaccggtttcatcctcagaaatgctgcaagtcacccaagcc
gcagtccaccagctagttaccgaaaataaatttgtcatctccctcggaggcgaacacagc
atcactgcaggcgttgtggaaggttatcgccaagcatacccaaacgaacctttcacagtc
gtgcaaatcgacgcccacggcgacttgcggcacgagtacgaaggttcgattcacaaccac
gcctgcgtgatgcgacgtattgtagatatgggcttaccgactctgcaaatcgggattcgc
gctatctgcaaggaagaagccgacttgattaaagcaaaacagctaaacgtgattcgagct
cgcgaaatcgctactcaaccggattgggccgatcgggcaattgccagcataacaactaag
cgagtatttttgacgatcgacttagacggcatcgatccgactttaattccaggagtggga
acacccgaaccgggcggcttaaattggtattctctcaccggatttttgcgccgcatcttc
gagtcctacgaagtaatcgggtgtgacattatggaattagcaccggttgtagattctgta
gtctcagaatttaccgccgccaaattagcatacaaaatgatcgggtatcaagctctggct
caaggttggctaaagccagacgaggaataa

DBGET integrated database retrieval system