KEGG   Oscillatoria nigro-viridis: Osc7112_6228Help
Entry
Osc7112_6228      CDS       T02375                                 

Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
oni  Oscillatoria nigro-viridis
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:oni00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(7440040..7441233)
Genome map
AA seq 397 aa AA seqDB search
MTPLSWTELEALTDFEVDRVNGPTNAQARLRLFGKTESDVRVTLYRDNHAWCPYCQKIWL
WLEEKQIPYRIEKVTMFCYGEKESWYKRKVPSGMLPAIELDGRIITESDDILIALERVYG
PLGLGMENPAVIPLRRLERLLFRAWCTWLCYPASSAKAEQHNRNQFISVVAQVEKALAST
PGPYFLDEFGTADVIFTPYVERMNASLYYYKGYSMREENPRFADWFAAMETRPTYRGTQS
DFHTHVHDLPPQMGGCYENGEPQMLLNKARVDNGPWAGLPDVMYPEPETSRAEALHRVIK
HHRNIIRVNPADDKLFDEALRCALTLMMTGEVCTPPAGSDAALRYLRDRVNVPRDMSIYA
AKRLREALEETAALVGDGQGSPILLKHRRDQDPANFV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacccccctaagctggacagaattagaagccctcacagactttgaagtcgatcgcgtc
aacgggccaaccaacgcccaagcccgcttgcgcctgtttggtaaaaccgaatccgatgtc
cgagtcaccctgtaccgcgacaaccacgcctggtgtccctactgccaaaaaatctggttg
tggttggaagaaaaacaaatcccctaccgcattgaaaaagtcaccatgttctgctatggg
gaaaaagaaagttggtacaagcgcaaagtgccatcgggaatgctaccggcgatcgaacta
gacggccgcatcatcaccgaaagcgatgacatcttaatcgccctcgaacgagtctacggc
cccttgggtttgggcatggaaaacccggcagtaatacccctgcggcggttagagcgactg
ctgtttagggcctggtgtacctggctgtgctacccagcaagttcagccaaagcagaacag
cacaaccgcaaccaatttatcagcgtcgtcgcccaggtagaaaaggctctcgccagcact
ccggggccttatttcctcgatgaatttggcactgcggatgtcatctttacgccctacgtc
gaacgcatgaatgccagtctttactattacaaaggctactcgatgcgggaagaaaacccg
cgctttgctgactggtttgcggcgatggaaacccgccctacctatcgaggcactcagagc
gattttcacacccacgtccacgatttaccgcctcagatgggcgggtgttatgaaaacggc
gaacctcagatgctactcaataaagcccgcgtggataatgggccttgggctggactgccg
gatgtgatgtatccagaaccggaaacctcacgcgctgaagcacttcaccgcgtcattaag
caccaccgcaacatcattcgagtcaatcctgctgatgacaagttattcgatgaggctttg
cgttgtgctttaactttgatgatgactggcgaagtttgtacgccgccggctggttctgat
gcggctttgcggtatttgcgcgatcgggtgaatgtgccccgcgatatgtcgatttacgcg
gccaagcggctgagggaagcgttggaggaaacggcggctttggtgggtgatggccaaggt
tctccgattctgttgaagcatcggcgagatcaagatccggctaattttgtgtag

DBGET integrated database retrieval system