KEGG   Oenococcus oeni: OEOE_0088Help
Entry
OEOE_0088         CDS       T00408                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OEOE_0088
   01230 Biosynthesis of amino acids
    OEOE_0088
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_0088
  Energy metabolism
   00680 Methane metabolism
    OEOE_0088
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OEOE_0088
Enzymes [BR:ooe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OEOE_0088
Exosome [BR:ooe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OEOE_0088
  Exosomal proteins of melanoma cells
   OEOE_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(78883..79623)
Genome map
AA seq 246 aa AA seqDB search
MTIIDFIRHGEPDTHIHDDRLRPLTTRGQRQSHAIATNLIYIPYTAVYASPAARATETVQ
PLATVIGKEIIHDDRLLERQMPDWVVDFPGYVRKQWTDLTYAQAGGESIVQVQARYQAFM
QSLPQDGVVAVGTHGTAMSSVVEMIWPGHGAPFFSALRFADVIRVNIQARKLVSLMASRP
FSVLGQTMTVAIDQPLGKAYQERAQLIYPVNCGKVTQIVGGNVEKQDAYVLGQKYRCHPG
LETFRQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgactattattgatttcatcagacacggcgaaccagacacacatattcatgatgatcga
ttgcgaccactcacgactcgaggacagcggcagtcacatgcgattgcgacgaatctgatt
tatattccgtacacggctgtttacgcgagtcccgcggcgcgcgcaacagaaacggttcag
cctctcgcaacggtaattggaaaagaaatcattcatgacgatcgcttactcgaacgacag
atgccggattgggttgtagattttcctggatacgtccgtaagcaatggactgatttaaca
tacgcacaggcggggggcgaatcaatcgtgcaggttcaggcgcgataccaagcgtttatg
caatcattgccacaggatggggtggttgcggtcggcacacatggaacggctatgagtagc
gtggtggaaatgatttggccgggacacggtgcaccattcttctcagcgttaaggtttgcg
gacgtgatacgggtgaacattcaagcaagaaagctggttagtttgatggcgtcgcggcca
ttcagcgttcttggccagacaatgaccgtggcgattgaccaaccgttgggaaaagcgtac
caggaacgtgcccaacttatctatcctgtgaactgtggcaaagtgacacagattgtgggc
ggtaatgttgagaagcaggatgcctatgtgctgggccaaaagtaccgctgtcatcctgga
ctggaaacgttcaggcagtga

DBGET integrated database retrieval system