KEGG   Oenococcus oeni: OEOE_0088Help
Entry
OEOE_0088         CDS       T00408                                 

Definition
(GenBank) Phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ooe  Oenococcus oeni
Pathway
ooe00010  Glycolysis / Gluconeogenesis
ooe00260  Glycine, serine and threonine metabolism
ooe00680  Methane metabolism
ooe01100  Metabolic pathways
ooe01110  Biosynthesis of secondary metabolites
ooe01120  Microbial metabolism in diverse environments
ooe01130  Biosynthesis of antibiotics
ooe01200  Carbon metabolism
ooe01230  Biosynthesis of amino acids
Module
ooe_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_0088
  Energy metabolism
   00680 Methane metabolism
    OEOE_0088
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OEOE_0088
Enzymes [BR:ooe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OEOE_0088
Membrane trafficking [BR:ooe04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    OEOE_0088
Exosome [BR:ooe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OEOE_0088
  Exosomal proteins of melanoma cells
   OEOE_0088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ABJ56089
JGI: OEOE0088
UniProt: Q04HI3
Position
complement(78883..79623)
Genome map
AA seq 246 aa AA seqDB search
MTIIDFIRHGEPDTHIHDDRLRPLTTRGQRQSHAIATNLIYIPYTAVYASPAARATETVQ
PLATVIGKEIIHDDRLLERQMPDWVVDFPGYVRKQWTDLTYAQAGGESIVQVQARYQAFM
QSLPQDGVVAVGTHGTAMSSVVEMIWPGHGAPFFSALRFADVIRVNIQARKLVSLMASRP
FSVLGQTMTVAIDQPLGKAYQERAQLIYPVNCGKVTQIVGGNVEKQDAYVLGQKYRCHPG
LETFRQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgactattattgatttcatcagacacggcgaaccagacacacatattcatgatgatcga
ttgcgaccactcacgactcgaggacagcggcagtcacatgcgattgcgacgaatctgatt
tatattccgtacacggctgtttacgcgagtcccgcggcgcgcgcaacagaaacggttcag
cctctcgcaacggtaattggaaaagaaatcattcatgacgatcgcttactcgaacgacag
atgccggattgggttgtagattttcctggatacgtccgtaagcaatggactgatttaaca
tacgcacaggcggggggcgaatcaatcgtgcaggttcaggcgcgataccaagcgtttatg
caatcattgccacaggatggggtggttgcggtcggcacacatggaacggctatgagtagc
gtggtggaaatgatttggccgggacacggtgcaccattcttctcagcgttaaggtttgcg
gacgtgatacgggtgaacattcaagcaagaaagctggttagtttgatggcgtcgcggcca
ttcagcgttcttggccagacaatgaccgtggcgattgaccaaccgttgggaaaagcgtac
caggaacgtgcccaacttatctatcctgtgaactgtggcaaagtgacacagattgtgggc
ggtaatgttgagaagcaggatgcctatgtgctgggccaaaagtaccgctgtcatcctgga
ctggaaacgttcaggcagtga

DBGET integrated database retrieval system