KEGG   Oenococcus oeni: OEOE_0258Help
Entry
OEOE_0258         CDS       T00408                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ooe  Oenococcus oeni
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ooe00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ooe00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
245189..246115
Genome map
AA seq 308 aa AA seqDB search
MANVFVNINDLSNQELLSMIHQALLFKSGQFIPVINRQVVANLFFENSTRTATSFQMAEM
KLGYQRIVIDPNKSSATKGESLEDTLKTLKAIGIDTIVIRHSLRDWYQPFYEMAGKEVPK
LVNAGDGNGQHPSQSLLDLMTIVEHFENFVGLRVRIIGDIYHSRVARSNAEILNRLGVEV
TFSGPKEWQDQSLEQFGSFVGIDKDLGKQDVIMLLRVQHERLTDEENQDFTIDKYHEDYG
LTQDRYRKLKSNAIIMHPAPVNRDVEIDSDLVESDKSRIFQQMKNGVYARMAILNSLTIP
SLISGVGK
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatgtttttgtgaacattaacgacttatcgaatcaggagttgttatcaatgatt
caccaagctttattatttaaaagcggtcaatttatacccgtgataaatcggcaggttgtt
gccaatctcttttttgagaattcaaccagaacggcgaccagttttcaaatggcagaaatg
aaattgggttatcagcgaattgtgatcgatcccaacaagtcctcggcaacaaaaggtgaa
agtcttgaagatactctgaaaacacttaaagcaatcggcatcgatacaatcgttattaga
cacagccttcgtgactggtaccagcctttttacgaaatggccggcaaagaagttcctaag
ttggtgaatgctggggatggcaatggccagcatccctcacaaagcctattggacttgatg
acgatcgtcgaacactttgagaattttgttggattgagagttcgtattattggcgatata
taccattcgcgtgtcgctcgatcaaatgcagaaatattaaatcgtttaggtgtcgaagtg
actttctccggtcccaaagaatggcaggatcaatcattggaacaatttgggtcctttgtt
ggtatcgacaaagatcttggaaaacaggacgtaattatgttgttaagagttcagcatgaa
cgtctgacagacgaagaaaatcaagattttacaattgataaatatcatgaagactatggt
ttaacacaagatcgttatcgaaagctaaagagtaatgcgattattatgcatccagcaccg
gttaaccgggatgttgaaattgatagtgatttggtcgagtctgataaatctcgtattttc
caacaaatgaaaaatggcgtttatgctcgaatggcaattttgaattcgctaaccattcca
tctttaataagcggggtcggtaaatga

DBGET integrated database retrieval system