KEGG   Oenococcus oeni: OEOE_0310Help
Entry
OEOE_0310         CDS       T00408                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OEOE_0310
   01230 Biosynthesis of amino acids
    OEOE_0310
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_0310
  Energy metabolism
   00680 Methane metabolism
    OEOE_0310
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OEOE_0310
Enzymes [BR:ooe01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     OEOE_0310
Exosome [BR:ooe04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   OEOE_0310
  Exosomal proteins of melanoma cells
   OEOE_0310
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
303793..304461
Genome map
AA seq 222 aa AA seqDB search
MSKLVLIRHGESTANHDNIFTGWTDVPLTEKGISQAHVAGKQLSHSGIDFDIVYTSMLQR
AIVTSYIILNEINQAWLPIVKSWRLNERHYGALRGLNKAETAQKYGDTQVREWRRSYTTV
PPLLGHEESSERYLKLGIKEPLGESAEMSWKRVQPFWEDQIAKQLRSEKNVLLVAHGSSI
RVLLKFLDRISDDNFMKVEVGNGEPIIYNFDQQLKVISKSNL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacttgtattaatccgtcatggggaatcgactgctaatcacgataatattttt
accggctggaccgatgttccgttaactgaaaaagggatctctcaagcacatgttgctgga
aaacagttgtcacactctggaattgattttgatatcgtttatacttcaatgctccaaaga
gcgattgtaaccagctatattattttgaatgaaatcaatcaggcctggctcccgatagtc
aagtcctggcgtctaaacgaacggcattatggagctttacgcggccttaataaagccgaa
accgcacaaaagtatggagatactcaggtcagagagtggcgccgcagttatacgaccgtt
ccaccacttttgggtcacgaagaatcttccgagcgttatttaaaactgggaattaaagaa
cctcttggcgagtcggccgaaatgtcttggaaacgtgttcaacctttttgggaagatcaa
attgccaaacagcttcgaagtgaaaagaatgttttgttggttgcccacggttcttctatt
agagttttattaaagtttttggatcgcatatctgacgataattttatgaaagttgaagtt
ggcaacggggaaccgattatttataattttgatcagcagctaaaagttatttccaaaagt
aatctttag

  All links  
No link information was found.   
DBGET integrated database retrieval system