KEGG   Oenococcus oeni: OEOE_0310Help
Entry
OEOE_0310         CDS       T00408                                 

Definition
phosphoglycerate mutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:ooe01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ooe01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ooe00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:ooe00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ooe00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
303793..304461
Genome map
AA seq 222 aa AA seqDB search
MSKLVLIRHGESTANHDNIFTGWTDVPLTEKGISQAHVAGKQLSHSGIDFDIVYTSMLQR
AIVTSYIILNEINQAWLPIVKSWRLNERHYGALRGLNKAETAQKYGDTQVREWRRSYTTV
PPLLGHEESSERYLKLGIKEPLGESAEMSWKRVQPFWEDQIAKQLRSEKNVLLVAHGSSI
RVLLKFLDRISDDNFMKVEVGNGEPIIYNFDQQLKVISKSNL
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaacttgtattaatccgtcatggggaatcgactgctaatcacgataatattttt
accggctggaccgatgttccgttaactgaaaaagggatctctcaagcacatgttgctgga
aaacagttgtcacactctggaattgattttgatatcgtttatacttcaatgctccaaaga
gcgattgtaaccagctatattattttgaatgaaatcaatcaggcctggctcccgatagtc
aagtcctggcgtctaaacgaacggcattatggagctttacgcggccttaataaagccgaa
accgcacaaaagtatggagatactcaggtcagagagtggcgccgcagttatacgaccgtt
ccaccacttttgggtcacgaagaatcttccgagcgttatttaaaactgggaattaaagaa
cctcttggcgagtcggccgaaatgtcttggaaacgtgttcaacctttttgggaagatcaa
attgccaaacagcttcgaagtgaaaagaatgttttgttggttgcccacggttcttctatt
agagttttattaaagtttttggatcgcatatctgacgataattttatgaaagttgaagtt
ggcaacggggaaccgattatttataattttgatcagcagctaaaagttatttccaaaagt
aatctttag

DBGET integrated database retrieval system