KEGG   Oenococcus oeni: OEOE_0341Help
Entry
OEOE_0341         CDS       T00408                                 

Definition
Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_0341
Enzymes [BR:ooe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     OEOE_0341
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
331260..332717
Genome map
AA seq 485 aa AA seqDB search
MTETTKSGLRKDFLWGGAVAANQLEGAWDVDGKGVSVSDIMTAGAYQKPREITDGIIAGK
NYPNHEAIDFYHHYKDDIKMFAEMGFKCFRTSIAWTRIFPNGDETEPNEAGLKFYDDMFD
ECLKYGIEPVITLSHFEMPYHLVTEYGGWRNRKVIDFFVKFATVCFKRYKDKVKYWMTFN
EINNQTTFTNDFSIATDSGLIFRNKESEAEREALMYQASHYEVVASALAVKIGHKINPDF
EIGNMVNFTPVYPASSDPKDILLAEKAMQRRYWWADVQALGEYPVGMEAYFKNHDLRPDI
TAEDRVVLREGTVDYVGFSYYNSMTVKYSDDNPEFKFVGDREAVKNPNLKYNDWGWPVDP
VGLRYSMNWLTEHYHKPVMIVENGFGAYDKVESDGSIHDDYRVDYLRAHVKQMITAVNED
GVDLMGYTPWGCIDLVSAGTGQMSKRYGFIYVDKDDEGNGTLERSKKDSFYWYQKVIRSN
GLDLD
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgactgaaacaacaaaaagtggattaagaaaagattttctctggggaggagccgttgct
gcaaaccaactcgaaggagcttgggatgttgacggcaaaggtgtcagtgtatcggatatt
atgacagctggtgcttatcaaaaaccccgtgagattactgatggcataattgctggcaaa
aattatcctaatcatgaggctattgatttttatcatcattacaaagatgatattaaaatg
tttgccgaaatgggctttaagtgttttagaacatctattgcttggacaagaatttttccc
aatggtgatgaaacggaacctaatgaagctggtttgaaattttatgatgatatgtttgat
gaatgcttaaagtatggtattgaaccagttattactttgtcacattttgaaatgccatat
catttagttacagaatatggtggttggagaaatcgtaaggtaattgatttctttgttaag
tttgcgacagtttgtttcaaacgttacaaggataaggttaagtattggatgactttcaat
gaaattaacaatcaaacaacctttacaaatgatttctctattgcaactgattctggtttg
atttttagaaataaagaatctgaagcagaacgtgaagccttgatgtatcaagcatcacat
tatgaagtcgttgctagtgctttggcagtgaaaattggtcacaagatcaatcctgatttt
gaaattggtaatatggtcaactttactccagtttatccagcatcatcagatcctaaggac
atcttattggctgaaaaagctatgcaaagacgttactggtgggctgatgttcaagctttg
ggtgaatatccagttggtatggaagcatacttcaagaatcatgacctaagaccagatatt
acagctgaagatcgcgttgttttacgtgaaggaacagttgattatgttggctttagttat
tataattctatgactgttaagtatagtgatgacaatcctgaatttaagtttgttggtgat
cgtgaagcagttaagaatcctaaccttaaatacaatgattggggttggcctgttgatcca
gttggtttgagatattcaatgaactggttgactgaacactatcacaagccagtgatgatc
gttgaaaatggttttggtgcatatgataaagttgaatcagatggcagtatccatgatgat
tatcgtgttgattacttgcgtgcccacgtcaaacaaatgattacagcagttaatgaagat
ggcgtagatcttatgggttacactccatggggctgcattgatttagtttctgctggaaca
ggtcaaatgtccaaacgttacggattcatttatgtcgataaagatgatgaaggtaacgga
acacttgaacgttcaaagaaagattcattctattggtatcaaaaagtaatccgttcgaac
ggattagacttagactga

DBGET integrated database retrieval system