KEGG   Oenococcus oeni: OEOE_0565Help
Entry
OEOE_0565         CDS       T00408                                 

Definition
UDP-glucose pyrophosphorylase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ooe  Oenococcus oeni
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    OEOE_0565
   00052 Galactose metabolism
    OEOE_0565
   00500 Starch and sucrose metabolism
    OEOE_0565
   00520 Amino sugar and nucleotide sugar metabolism
    OEOE_0565
Enzymes [BR:ooe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     OEOE_0565
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
543073..543948
Genome map
AA seq 291 aa AA seqDB search
MVQKVKKAVIPAAGLGTRFLPATKALAKEMLPIVDTPTIQFIVEEAIQSGIEDIVIVDGK
SKRSIEDHFDSNTELEDNLSAKGKDKLLKLVQDTTDLNIYFIRQSHPHGLGDAVLKAKSF
ISNEPFVVMLGDDLMTDRVPLTKQLVDRYNETEQSTLAVMPVPHEETSKYGVIDPSKEVK
PGLFEVKNFVEKPRPQDAPSDLAIIGRYLFTPTIFSELENTMPGKGNEIQLTDAIESLNH
KEHVYAHQFDGKRYDIGSKIGFLETNIEFGLKHPDTGDELRKYIKELAKTL
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggtacaaaaagttaaaaaggccgtcattccggccgctggattgggcacacggtttttg
cctgcaaccaaggctttggcaaaggaaatgctgccaattgttgatacgccgacaatccaa
tttatcgttgaagaagcaattcagtcaggaatcgaagatatcgttatcgtcgacggaaaa
tcaaaacgatcaattgaagaccattttgattccaacacggaattggaagacaatttgtct
gccaagggtaaagacaagttattgaaattagttcaggatacgactgatttgaatatctat
ttcattagacagtctcatccacatggtttgggcgatgctgttttaaaggccaagtctttt
attagcaatgaaccctttgttgtaatgcttggtgatgatctgatgaccgatcgtgttcct
ttgactaaacaattggttgatcgttataacgaaaccgagcaatcgactttggcagtcatg
ccggttcctcatgaagaaacttcaaaatatggcgtaatcgatccttctaaggaagttaag
ccgggactgttcgaagttaaaaattttgttgaaaaacctcgtcctcaggatgcaccttcc
gatttggcaattattggtcgttacctatttacaccaacaattttttccgaactggaaaat
acaatgcccggcaagggcaacgagattcagttgactgatgcgattgaaagcctgaaccat
aaagaacatgtttacgctcatcaatttgatggtaaacgctatgatattggttcaaagatc
ggctttcttgaaacgaatattgaatttggattaaagcatcccgatactggcgatgaactt
cgcaagtatattaaagaacttgccaagactctttaa

DBGET integrated database retrieval system