KEGG   Oenococcus oeni: OEOE_0577Help
Entry
OEOE_0577         CDS       T00408                                 

Definition
Holliday junction resolvasome, DNA-binding subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ooe  Oenococcus oeni
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OEOE_0577
Enzymes [BR:ooe01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     OEOE_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
554781..555365
Genome map
AA seq 194 aa AA seqDB search
MYDFLTGIIKTIAAGYVGIDVNGIGFRVFTPNPYEYNQNDQTTIFTEQIVRDNQISLYGF
KTVKERNLFQKLLNVSGIGPKSALAIIAGGDRDGLIAAVENGKPKYLTKFPGIGNKTAQQ
IVLDLKGKLGDFSKNIAPMKNLLENSAELDDALAALVALGFSSKEVNKINPKLASLGELT
TDAYIQKGLKLLTK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgtatgactttttgacgggcatcattaaaacgatcgcggcgggttacgtgggcatcgat
gttaatggaattggttttcgcgtttttacgcccaacccttatgaatataatcaaaacgat
caaacgacaatctttactgaacaaattgttcgtgataatcagattagtctttatggtttt
aaaacagttaaagaaaggaatctttttcaaaaactgctcaatgtttccggaatcggacca
aaatcggccttggcaattattgccggtggcgatcgtgatgggctgattgccgctgtcgag
aacggtaaaccgaaatatttaactaagttcccgggtatcggaaataaaaccgcccaacag
atcgttcttgatctcaagggaaaattgggcgatttttcgaaaaatatcgctccgatgaag
aatctgttggaaaattctgctgaattggatgatgccttggccgccctagtggctttgggc
ttttcttcaaaagaagttaacaaaataaatccaaaattagccagtcttggtgaattaaca
accgatgcatatattcaaaaaggacttaaactattaaccaaatga

DBGET integrated database retrieval system