KEGG   Oenococcus oeni: OEOE_0636Help
Entry
OEOE_0636         CDS       T00408                                 

Definition
glucose-6-phosphate isomerase (EC:5.3.1.9)
Orthology
K01810  
glucose-6-phosphate isomerase [EC:5.3.1.9]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ooe01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ooe00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ooe00030]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ooe00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ooe00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
598734..600050
Genome map
AA seq 438 aa AA seqDB search
MKVTFKKDYLKDFVADSEVELLKPTAGFVRDTLLARTGVGNEMEDWLTLPSDYDKEEFAR
ILKVADKIKSDSKVLVVIGIGGSYLGARAVIEFLKSEFHNEKANKEGLPEVYFVGTSASG
RYIDDVIDLIGNRDFSINIISKSGTTTEPAIAFRTFKSLIEKKYGKEEASKRIFATTDAH
KGALLNVAKENGYERFVVPDGIGGRYSVLSAVGLLPIAVAGINIQKLMDGAKAAQEEFAK
DEDILNKPSILYAIYRNILYRKGFDVETIVGYEPQFRFLFEWWKQLMAESEGKDNKGIYP
TSAIFSTDLHSIGQYIQDGKKILFETILDITKPISDRVVPSADDNTDNLDYILNKPMKEV
NEAALTATAQAHTSAGVPNILLQLDDLDEFNLGNLIYFFEAAVAVSGYLDGINPFDQPGV
EIYKTNMFKILGKPGYTD
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgaaggttactttcaaaaaagattacttaaaagattttgttgccgattccgaggttgaa
ttgctaaaaccaacggccggttttgtccgtgacacattgcttgcccgtactggcgttggt
aatgagatggaggattggctgactttgccaagcgactacgataaagaagagtttgctcgg
attttaaaggtcgctgataaaattaagtctgattctaaagtcttggtcgtgattggaatt
ggcggttcttatctcggcgctcgagcagtaattgagttcttaaagtccgagttccataac
gaaaaggcaaataaagaaggtcttcctgaagtatatttcgttggtacttccgcttctggt
cgctatattgatgatgtaatcgatttgattggcaaccgtgatttttcgattaatattatt
tccaaatcgggaaccacaaccgagcctgcgattgctttccgtacttttaagagcttaatt
gaaaaaaagtatggcaaggaagaagccagcaaacgaattttcgcgacaactgatgctcat
aaaggtgcccttttgaacgttgcaaaagaaaatggctatgagcgtttcgttgttcctgat
ggtataggtggaagatactcagtattaagcgctgttggtcttttaccaattgccgttgct
ggaatcaacattcagaagttgatggatggcgccaaggcagcccaggaagaatttgccaaa
gacgaagatattctaaacaaaccatcgattctttatgcaatctatcgaaacattttgtac
cgaaaaggttttgatgtcgagacgattgttggttatgaaccacagttcaggttcttattt
gaatggtggaaacaattgatggctgagtctgaaggaaaagacaataagggcatttatcca
acctcagcgattttctcgactgatttgcattctatcggccagtacattcaagatggtaag
aaaattctattcgaaacgattttggatattaccaagccgattagcgatcgcgttgttcca
tcagctgatgataatactgataatcttgactatattttaaataagccgatgaaagaggtc
aatgaagccgcacttacagctactgcacaagcccacacttcggctggcgttccaaacatt
cttttgcagttggatgatctcgatgaatttaatttgggtaacctaatttatttctttgag
gctgctgttgcggtttccggttacttggatggtattaatccatttgatcagcccggtgtt
gaaatttataaaacaaatatgtttaaaattcttggcaaaccaggttatacagattaa

DBGET integrated database retrieval system