KEGG   Oenococcus oeni: OEOE_0788Help
Entry
OEOE_0788         CDS       T00408                                 

Definition
(GenBank) Serine/threonine protein phosphatase
  KO
K20074  
PPM family protein phosphatase [EC:3.1.3.16]
Organism
ooe  Oenococcus oeni
Brite
Enzymes [BR:ooe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     OEOE_0788
Protein phosphatases and associated proteins [BR:ooe01009]
 Protein Ser/ Thr phosphatases
  Mg2+- or Mn2+- dependent protein phosphatases (PPMs)
   PPM1 phosphatases (PP2C)
    OEOE_0788
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
737853..738596
Genome map
AA seq 247 aa AA seqDB search
MQIAYLSDIGTRKKENQDFVGIFTNKSQYKLAIVADGVTSEKGGDIAAEMVVNNFGFGWR
QTDISSIEEAKTWISKKAREENSRILMAGKRFDDLSQMATTMVLTVAINNDVLIGNLGDS
RAYIFDGKILKQLSFDHSFGNELIQNGQISKENVNNVPHHQSITRYFGLNAQTEMSFAVD
KVKNNDIIMLATDGLTKQVKESDILHVIKSKHKSLSEMVARLINMANEQSGFDNVTVLLM
SQFLEDN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcaaatcgcctatttaagtgatattggaactagaaaaaaagaaaaccaggactttgtc
gggattttcacgaataaaagtcagtataaattggccattgtcgctgatggggttaccagt
gaaaaaggtggtgatatcgccgcagagatggttgtcaataattttggttttggctggcgc
cagactgatatttcttcaatcgaagaagcgaagacctggatttctaagaaggcccgtgaa
gagaatagccgaattttaatggctgggaaacgttttgatgatttgtcccaaatggcaacc
acgatggttttaacggttgccattaataatgacgttttgattggcaatttaggcgactcg
agagcttatatctttgatggtaaaattctaaaacaactttcattcgatcattcctttggt
aatgaattaattcaaaatggacaaatttcaaaggaaaatgtcaataatgttcctcaccat
caaagcattacgcgttattttggtttgaatgcgcaaaccgaaatgtcttttgctgtcgac
aaggtaaaaaacaacgatattatcatgcttgcaacggatggcttgactaagcaggttaaa
gaatcggatattttgcatgttattaagtcaaagcacaaatctctcagcgaaatggtggct
cggctgatcaatatggctaacgaacaaagcggtttcgataacgtcacggttctgttgatg
tcgcaatttttggaggataattga

DBGET integrated database retrieval system