KEGG   Oenococcus oeni: OEOE_0920Help
Entry
OEOE_0920         CDS       T00408                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    OEOE_0920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_0920
   00052 Galactose metabolism
    OEOE_0920
   00500 Starch and sucrose metabolism
    OEOE_0920
   00520 Amino sugar and nucleotide sugar metabolism
    OEOE_0920
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    OEOE_0920
   00524 Butirosin and neomycin biosynthesis
    OEOE_0920
Enzymes [BR:ooe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     OEOE_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
863297..864268
Genome map
AA seq 323 aa AA seqDB search
MTKDKLIGVDLGGTTIKFAILTIEGEIQEKWAVPTNILDDGSHIVPDIVNSINKRLGLLK
LDRERIVGIGMGTPGTVDRQNGTVEAAYNLNWKNIQHVREAVQKGTGLDFTIDNDANSAA
IGEQWKGAGENNPNVAFVTLGTGVGGGIIANGHMVRGVFGAGGEFGHVVVEPNGYLCTCG
NRGCLEQYCSAPGVVHLAHDFADEYEGNSQLKQMLDNGEDVTSKTVFDLAKNGDFLATEI
VDKMAYYLGYATASLSNILNPAYVVIGGGVSAAGSFLLNKVQKHWTKYAFSPVRSSTKLK
LAVLGNDAGVIGAASLAREFIKK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgactaaagataaattaattggtgtcgatcttggcggaacgacaattaaatttgcaatt
ctaacaattgaaggtgaaatccaagagaaatgggctgtaccaactaatattctcgatgat
ggttctcatattgttcctgatattgttaattctattaataaaagacttggtcttttaaaa
cttgatcgagaaagaattgttgggattggaatgggaacgcctggtaccgttgaccgccaa
aacggaaccgttgaagctgcttacaatttaaattggaaaaatattcagcatgttcgcgaa
gcggttcaaaagggaaccggcttagattttacgattgataatgatgctaattcagcggca
atcggcgaacaatggaaaggtgccggcgaaaataatccaaacgttgcctttgttactctt
ggaaccggtgttggcggtggtatcatcgctaacggccacatggttcgcggagtttttgga
gctggaggagaatttgggcatgttgttgttgagccaaacggttatctttgcacttgtggt
aatcgcggctgtttggaacaatattgttccgcacccggagtcgttcatttagctcatgat
tttgccgacgagtatgaaggaaattcccaactcaaacaaatgcttgataatggagaagat
gtaacttcgaaaactgtttttgatttagcaaagaatggtgactttttggcgactgagatt
gttgataaaatggcctactatcttggctatgctacggcttcgttatcgaatatcctgaac
ccggcatatgtggttataggcggtggcgtttctgctgctggcagttttttgctgaataaa
gttcagaaacattggactaagtatgcgttttcaccagtgcgttcttctactaaattgaag
ctggccgttttgggaaatgacgccggtgttattggtgcagccagcttggcacgcgaattt
ataaaaaaataa

DBGET integrated database retrieval system