KEGG   Oenococcus oeni: OEOE_0947Help
Entry
OEOE_0947         CDS       T00408                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
ooe  Oenococcus oeni
Pathway
ooe00330  Arginine and proline metabolism
ooe00332  Carbapenem biosynthesis
ooe01100  Metabolic pathways
ooe01130  Biosynthesis of antibiotics
ooe01230  Biosynthesis of amino acids
Module
ooe_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    OEOE_0947
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    OEOE_0947
Enzymes [BR:ooe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     OEOE_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase
Motif
Other DBs
NCBI-ProteinID: ABJ56859
JGI: OEOE0947
UniProt: Q04FB3
Position
886964..887770
Genome map
AA seq 268 aa AA seqDB search
MAEKSFDNWKKIVVKVGTSTIVQENSQINLPIIGQLVQTLCALRNQNREVVFVTSGAVGV
AINQLGFKERPNEIPRQQALAAIGQADLMAIYNQNFSFYHQITGQILLTYDVFDNPKMLE
NMLNALRELLKMKAIPIINENDVIAVDEMDHQHSFGDNDCLAAMVTKIIDADGLIILSDV
DALYDRNPHEFANAKAIKRVGSITKQVINLASGKSNLGKGGMLTKLKAAKYLLKNDKQML
LLPGSEPDGILKALSGQEIGTLFANEYK
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaaaaagtttcgataattggaaaaaaatcgttgttaaagttggtacttcaacg
attgttcaagaaaatagccagattaatttaccgataatcggtcaattggttcagacgctt
tgtgctttgcgaaatcaaaaccgggaagtagtttttgtaacttccggggcggttggcgtt
gcgataaatcagcttggatttaaagaacgtccaaacgaaattcctcgacaacaggcttta
gcagcgattggccaagctgatttaatggctatttacaatcaaaacttttctttttatcac
cagattaccggtcaaattcttttgacttatgatgtattcgataatccaaaaatgctcgaa
aatatgttaaatgccttgcgggaattgctgaaaatgaaggcaattccgattattaatgag
aacgacgtaattgccgttgacgaaatggatcatcaacattcgtttggtgataacgactgc
ttagcggcgatggtaacaaaaattatcgatgccgatggtttgattattttatcagatgtt
gatgcactttatgatagaaatcctcatgagtttgccaatgctaaagctatcaagcgggtt
ggttcgatcaccaagcaggttattaatttggcctccggcaaaagcaatctcggaaaaggt
ggaatgttaacaaaattaaaagcagctaagtatcttttaaaaaatgataagcaaatgcta
ttacttcctggatccgaacctgatggtattttgaaggctctttcgggtcaagagattgga
actttattcgccaatgaatacaaataa

DBGET integrated database retrieval system