KEGG   Oenococcus oeni: OEOE_1013Help
Entry
OEOE_1013         CDS       T00408                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
ooe  Oenococcus oeni
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    OEOE_1013
   00670 One carbon pool by folate
    OEOE_1013
Enzymes [BR:ooe01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     OEOE_1013
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
948223..948735
Genome map
AA seq 170 aa AA seqDB search
MITSIWAQSKNNVIGRNNHLPWSLPDDLKFFRQETKNKAVVMGRKTYESFGSKALPKRLN
IILTSNMDFKSNDPEVKIVHSPIEAVNTAKEQHLPLYVIGGASVYESFMNMADRLLITLV
DANIKGDTFAPNFSEKSFSLVSQCHHAQDKKHAYSFDFLTYERKNKSDQV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgattacatcaatatgggcacaatcaaaaaataatgtgattggcagaaacaatcacttg
ccatggtccctaccggatgatcttaaattttttcgccaggaaactaaaaataaggcagtg
gtaatgggtcgaaaaacctatgagtcttttggttcaaaagcattgccaaaacgtttaaac
attattttaacttccaatatggattttaagagcaacgatccggaggtaaaaatcgtgcat
tctccaatcgaggctgtcaatacagcaaaagaacagcatttacccctttatgtaatagga
ggagccagcgtttacgaaagttttatgaatatggctgatcggttattgattactttggtt
gatgctaatattaagggagacacatttgcaccaaattttagtgaaaagtcttttagttta
gtttcccaatgtcatcatgctcaagataagaaacacgcttattcttttgattttctgact
tatgagaggaaaaataaaagcgatcaagtataa

DBGET integrated database retrieval system