KEGG   Oenococcus oeni: OEOE_1106Help
Entry
OEOE_1106         CDS       T00408                                 

Definition
(GenBank) ATP-dependent DNA helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ooe  Oenococcus oeni
Pathway
ooe03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OEOE_1106
Enzymes [BR:ooe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     OEOE_1106
DNA repair and recombination proteins [BR:ooe03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     OEOE_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 AAA_11 Viral_helicase1 AAA_22 AAA AAA_16 RsgA_GTPase UvrD_C PhoH Helicase_RecD NTPase_1 T2SSE AAA_12 HHH_5 UvrD-helicase ABC_tran NACHT cobW DUF2075 5_3_exonuc DNA_pol_lambd_f AAA_29 RNA_helicase Zeta_toxin TsaE HHH AAA_28
Motif
Other DBs
NCBI-ProteinID: ABJ57005
JGI: OEOE1106
UniProt: Q04EW7
Position
complement(1037575..1039875)
Genome map
AA seq 766 aa AA seqDB search
MAQLVASIKKSFFKNSANNYAVFLAKVSNDDFDWEETEITLTGEIADLKIGESYEFSGKL
TIHPKYGKQFNVFDYQSVLPDDNDGLIDFLSSDLFEGVGRKTAEKIVDNFGGESLDTIVD
KPDQLKTLGLKKKQIANMRAVLLSNQEKTKAIARSGQYGLSQSLIERLFDQFGSDFTNLL
SENPYQLIGQVDGFTFQDAQQIARFNNFNHQEDQIDGAVIFSLLTAAQESGDTYLSKDQL
VKNVSELLESGPEFFDQEILTEIESLQRKGQLFISDSRVSLAEYYRLEESVIDDLKRVSK
NKQRSFTGKLQLSNKSLLDDKQKKAVESVFKNQITILTGGPGTGKTTVIKTVIQQWERAA
EKSNSENKFKQTKKLVLLAAPTGRAAARITEVTGRQAVTIHHLLGATSDGYFDFDENNQL
QAGLIVIDEMSMVDLQLFQHFLRAVPNGCRLLLVGDKDQLPSVGAGQILTDLILSDQFKT
IELQINHRQTKGSGIDLLSQDLKRGIVDQKMFENGNDISFFSLEEYQLEQGISRILSAAM
RFGIKKEDLQIITPTNRLVELLNQLARPYLIDRDIRIDDLSTAFLAGDRVMQQENNPEKG
VNNGDIGYVIATQLSGPLRSRFISVDFLGNTVMYKENEINQLRLSYASTVHKSQGSEFRN
VIFVLTSTFNNFVTRNLVYTGVTRAEKSLILIGSQRAFTDAINNPTPLRQTNLVKLLNGV
DRPVALATKKEANESPGYVLSKELIENNQIDPMIGMNGIKPGDFIK
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaattagtagcaagtataaaaaaatctttttttaaaaacagtgctaataattat
gctgtttttttggcgaaagtatccaatgatgatttcgattgggaagagacggaaatcact
cttacgggcgaaattgccgatttaaaaatcggcgagtcttatgaattctccggaaaatta
acgattcatccgaaatatggaaaacagtttaatgtctttgactatcagtccgttttgccg
gatgataacgatggattaatagattttctcagttctgatctttttgagggagtcgggaga
aagacggccgagaagatcgtagataattttggcggtgaatcgcttgatacgattgttgat
aaacctgatcagttgaagacactcggtttgaagaaaaaacaaattgcaaatatgcgggcc
gttcttttaagcaatcaggaaaaaaccaaagcaattgctcgaagcggtcagtatggcctt
agccagtctttgatcgagcgattgtttgaccaatttggttccgattttacaaatcttttg
tcggaaaacccctatcaattaattggccaggttgatggattcacttttcaagatgctcag
cagattgcccgattcaataattttaatcatcaagaagaccagatcgatggagcagtcatt
ttcagtttattgacggcagcccaagaaagtggggatacttacttaagcaaagaccagctc
gtaaagaatgtttcagaacttttggaaagcggacccgagtttttcgatcaggaaattttg
actgaaatcgaaagtttgcaaaggaaagggcaactattcatttccgatagccgcgtttct
ctagctgaatattatcgtttggaagaatcggttatcgatgatttaaaacgtgtttcaaaa
aacaaacagcgttctttcaccggaaaactgcaactttccaataagtcgttacttgacgat
aagcaaaaaaaggccgtagaatcggttttcaaaaatcagataacgatactgactggtgga
ccagggactggcaaaactactgttatcaagactgttatccagcaatgggaaagagcggcc
gagaagtctaattcggaaaataaattcaaacaaacgaaaaaattggttttgttggctgct
ccgaccggtcgtgctgcagctcgtattacagaagtaaccggacgtcaggctgtcacaatt
catcacctgcttggggcgacctctgatggatattttgatttcgatgaaaataatcagctg
caggccggattgattgtaattgatgaaatgtcaatggttgatctacaactcttccagcat
ttcttgcgagcggtacctaacggttgccgtttactgttggttggcgataaagatcagctt
ccatcggttggcgccggtcaaattttaactgacttaattctcagcgatcaatttaaaaca
atcgaattacagatcaatcatcggcagacgaagggctctggaatcgatcttttatcacag
gatttgaaacggggaatcgtcgatcaaaaaatgtttgaaaacggtaatgatatctctttc
ttttctcttgaagaataccagttggaacaagggatcagtcgaattttgtccgcagcaatg
cgttttggtattaaaaaggaagatttacaaatcatcactccgacgaatcgacttgtcgaa
cttctaaaccaactggcacgtccatatttaattgatcgagatatccggattgatgattta
tcgactgcttttctggctggggatcgggttatgcagcaggaaaacaatccggaaaaaggt
gtcaataacggtgatataggatatgtgattgctacgcaattgtctggtccgcttcgttca
cgattcatatcggttgattttcttggtaatactgtcatgtataaagagaatgaaattaat
caactacggcttagctatgcatcgacagttcataagtcccaaggcagtgagtttagaaat
gttatttttgtgttgacaagcacctttaataattttgtgacgagaaatcttgtctacacc
ggtgttacgcgtgccgagaaatcattgattttaattggcagtcaaagagcttttactgat
gcaatcaacaatccgacgcctttacggcagacaaatttagtaaaattattaaacggtgtc
gataggcctgtagcgctagcgaccaaaaaagaggcaaatgagtctcctggctatgtttta
agcaaagaattgattgaaaataatcaaatcgatccaatgattggtatgaacggaatcaaa
ccaggcgactttattaaataa

DBGET integrated database retrieval system