KEGG   Oenococcus oeni: OEOE_1106Help
Entry
OEOE_1106         CDS       T00408                                 

Definition
ATP-dependent RecD/TraA family DNA helicase
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ooe  Oenococcus oeni
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    OEOE_1106
Enzymes [BR:ooe01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     OEOE_1106
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1037575..1039875)
Genome map
AA seq 766 aa AA seqDB search
MAQLVASIKKSFFKNSANNYAVFLAKVSNDDFDWEETEITLTGEIADLKIGESYEFSGKL
TIHPKYGKQFNVFDYQSVLPDDNDGLIDFLSSDLFEGVGRKTAEKIVDNFGGESLDTIVD
KPDQLKTLGLKKKQIANMRAVLLSNQEKTKAIARSGQYGLSQSLIERLFDQFGSDFTNLL
SENPYQLIGQVDGFTFQDAQQIARFNNFNHQEDQIDGAVIFSLLTAAQESGDTYLSKDQL
VKNVSELLESGPEFFDQEILTEIESLQRKGQLFISDSRVSLAEYYRLEESVIDDLKRVSK
NKQRSFTGKLQLSNKSLLDDKQKKAVESVFKNQITILTGGPGTGKTTVIKTVIQQWERAA
EKSNSENKFKQTKKLVLLAAPTGRAAARITEVTGRQAVTIHHLLGATSDGYFDFDENNQL
QAGLIVIDEMSMVDLQLFQHFLRAVPNGCRLLLVGDKDQLPSVGAGQILTDLILSDQFKT
IELQINHRQTKGSGIDLLSQDLKRGIVDQKMFENGNDISFFSLEEYQLEQGISRILSAAM
RFGIKKEDLQIITPTNRLVELLNQLARPYLIDRDIRIDDLSTAFLAGDRVMQQENNPEKG
VNNGDIGYVIATQLSGPLRSRFISVDFLGNTVMYKENEINQLRLSYASTVHKSQGSEFRN
VIFVLTSTFNNFVTRNLVYTGVTRAEKSLILIGSQRAFTDAINNPTPLRQTNLVKLLNGV
DRPVALATKKEANESPGYVLSKELIENNQIDPMIGMNGIKPGDFIK
NT seq 2301 nt NT seq  +upstreamnt  +downstreamnt
gtggcgcaattagtagcaagtataaaaaaatctttttttaaaaacagtgctaataattat
gctgtttttttggcgaaagtatccaatgatgatttcgattgggaagagacggaaatcact
cttacgggcgaaattgccgatttaaaaatcggcgagtcttatgaattctccggaaaatta
acgattcatccgaaatatggaaaacagtttaatgtctttgactatcagtccgttttgccg
gatgataacgatggattaatagattttctcagttctgatctttttgagggagtcgggaga
aagacggccgagaagatcgtagataattttggcggtgaatcgcttgatacgattgttgat
aaacctgatcagttgaagacactcggtttgaagaaaaaacaaattgcaaatatgcgggcc
gttcttttaagcaatcaggaaaaaaccaaagcaattgctcgaagcggtcagtatggcctt
agccagtctttgatcgagcgattgtttgaccaatttggttccgattttacaaatcttttg
tcggaaaacccctatcaattaattggccaggttgatggattcacttttcaagatgctcag
cagattgcccgattcaataattttaatcatcaagaagaccagatcgatggagcagtcatt
ttcagtttattgacggcagcccaagaaagtggggatacttacttaagcaaagaccagctc
gtaaagaatgtttcagaacttttggaaagcggacccgagtttttcgatcaggaaattttg
actgaaatcgaaagtttgcaaaggaaagggcaactattcatttccgatagccgcgtttct
ctagctgaatattatcgtttggaagaatcggttatcgatgatttaaaacgtgtttcaaaa
aacaaacagcgttctttcaccggaaaactgcaactttccaataagtcgttacttgacgat
aagcaaaaaaaggccgtagaatcggttttcaaaaatcagataacgatactgactggtgga
ccagggactggcaaaactactgttatcaagactgttatccagcaatgggaaagagcggcc
gagaagtctaattcggaaaataaattcaaacaaacgaaaaaattggttttgttggctgct
ccgaccggtcgtgctgcagctcgtattacagaagtaaccggacgtcaggctgtcacaatt
catcacctgcttggggcgacctctgatggatattttgatttcgatgaaaataatcagctg
caggccggattgattgtaattgatgaaatgtcaatggttgatctacaactcttccagcat
ttcttgcgagcggtacctaacggttgccgtttactgttggttggcgataaagatcagctt
ccatcggttggcgccggtcaaattttaactgacttaattctcagcgatcaatttaaaaca
atcgaattacagatcaatcatcggcagacgaagggctctggaatcgatcttttatcacag
gatttgaaacggggaatcgtcgatcaaaaaatgtttgaaaacggtaatgatatctctttc
ttttctcttgaagaataccagttggaacaagggatcagtcgaattttgtccgcagcaatg
cgttttggtattaaaaaggaagatttacaaatcatcactccgacgaatcgacttgtcgaa
cttctaaaccaactggcacgtccatatttaattgatcgagatatccggattgatgattta
tcgactgcttttctggctggggatcgggttatgcagcaggaaaacaatccggaaaaaggt
gtcaataacggtgatataggatatgtgattgctacgcaattgtctggtccgcttcgttca
cgattcatatcggttgattttcttggtaatactgtcatgtataaagagaatgaaattaat
caactacggcttagctatgcatcgacagttcataagtcccaaggcagtgagtttagaaat
gttatttttgtgttgacaagcacctttaataattttgtgacgagaaatcttgtctacacc
ggtgttacgcgtgccgagaaatcattgattttaattggcagtcaaagagcttttactgat
gcaatcaacaatccgacgcctttacggcagacaaatttagtaaaattattaaacggtgtc
gataggcctgtagcgctagcgaccaaaaaagaggcaaatgagtctcctggctatgtttta
agcaaagaattgattgaaaataatcaaatcgatccaatgattggtatgaacggaatcaaa
ccaggcgactttattaaataa

DBGET integrated database retrieval system