KEGG   Oenococcus oeni: OEOE_1183Help
Entry
OEOE_1183         CDS       T00408                                 

Definition
putative phosphoketolase
Orthology
K01621  
phosphoketolase [EC:4.1.2.9]
Organism
ooe  Oenococcus oeni
Pathway
Pentose phosphate pathway
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    OEOE_1183
Enzymes [BR:ooe01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     OEOE_1183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1118014..1120398)
Genome map
AA seq 794 aa AA seqDB search
MTINYDSKDYLKYVDAYWRAANYLSVGQLFLRNNPLLKDELQSKDVKIKPIGHWGTVAPQ
NFIYAHLNRAILKYDLNMFYIEGSGHGGQVMVSNSYLDGSYTETYPKVTQDIQGMQRLFK
QFSFPGGIASHAAPETPGSIHEGGELGYSISHGVGAILDNPDVIAAVEIGDGESETGPLA
ASWFSDKFINPIHDGAVLPIVQINGFKISNPTILSRMSDRDLTNYYHGMGWEPLFVETDG
SDNFKVHAEMADAVDKAIEKIKAIQKNARNNNDDSLPIWPMIVLRAPKGWTGPKKDLDGN
PIENSFRAHQVPIPVDANHLEHKDMLIDWMKSYKPEELFNEDGSLKEIVKVNQPKGQRRM
AMNPITNGGIKPRTLNMPDMERFAFPKNSLKNNKKPGMDLQVVSTFIAEIIKKNPINFRQ
FGPDETMSNRLWDEFKVTNRQWMQAVHEPNDQYMAHSGRILDAQLSEHQAEGWMEGYVLT
GRHAFFASYEAFTRVIDSMLTQYYKWLRKAVEQDWRHDYPSLNVINASHAFQQDHNGYTH
QDPGMLTHMAEKGHEFVNEFLPADANSLLAVMNKSLQVRNKINIIVASKHPRTQWFTIDE
AKELVDNGLGIIPWASNDDGVEPDVVFAAGGTEATMESLAAISLLHESFPELKFRFINVI
DLLKLRKKGDNDDYRGLSDLEFDHYFTREKPVVFSFHGFESLARDLFYDRHNHNVIFHGY
RENGDITTPFDMRVLNHLDRFHLAKDAINATKYADVAGQFDQRMDDMLAKHTAYICDQGT
DLPEVTSWQWQDIK
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgactattaattatgattcaaaggattatttgaaatatgttgatgcctattggcgggct
gccaattatctttcagtcggtcaacttttcttgagaaacaatccgttacttaaagacgaa
cttcagtccaaagacgttaagatcaagccgatcggtcattggggaacggttgcgccgcag
aattttatttatgctcatttaaatcgagcaattttaaaatacgatttaaatatgttttat
attgaaggctctggccatggtggccaggtgatggtttccaattcatatttggatgggtct
tataccgaaacttatccaaaagtaactcaggatattcaaggaatgcaacgtttattcaag
caattctcttttcctggcggaattgcttcacatgctgctccggaaactcctggatcgatt
cacgaaggaggagagctgggttattcgatttcgcatggagttggtgctattttggacaat
cccgatgtgattgctgctgttgaaatcggggatggtgaatcagaaacggggcctttggcc
gcatcgtggttttccgacaaattcattaatccgattcatgatggtgctgtgttgccgatt
gttcagattaatggatttaaaatttccaatccaacaattctttctcgcatgagcgatcgt
gatttgaccaattattatcatggaatgggttgggagcctttgttcgttgaaacggatggt
tcagataattttaaagtgcatgccgagatggccgatgctgttgataaggccattgaaaaa
attaaagctattcaaaaaaacgcccgtaataataatgatgattcattgccaatctggccg
atgattgtattacgtgctcctaaaggttggacaggtccaaaaaaagatttggatggtaat
ccgattgaaaattcatttcgggcacatcaggtgccgattccagtcgatgcaaatcatttg
gaacataaagatatgctgattgattggatgaagtcctacaaaccggaagaattgttcaat
gaggatggcagcttaaaagaaattgttaaggtaaatcagccaaaaggccaacggcgaatg
gcaatgaacccaatcacgaatggtggaataaagccaaggacattgaatatgcctgatatg
gaacgatttgcttttccgaaaaatagcttgaaaaacaataaaaaaccagggatggacctt
caggttgtttcaacatttattgccgaaataataaagaaaaatcctatcaatttccgtcag
ttcggtcccgatgaaacaatgtccaatcgtctctgggacgagtttaaagtcactaatcgt
cagtggatgcaagcagtccatgaaccaaatgatcaatatatggctcattctggtcgtatt
ctagatgctcaattgtctgaacatcaggccgagggatggatggaaggatacgttttgacc
ggccgacacgctttctttgcgtcctacgaagcctttacgcgtgtaattgattcgatgctg
actcaatattataagtggttgcgaaaagcggtcgagcaagattggcgtcacgattatcct
tcgttaaatgtcattaatgcttcacatgcttttcaacaggaccataatggttatactcat
caagatcccggtatgcttactcatatggctgaaaaaggtcatgagtttgtcaatgaattc
ttgccagccgatgctaattcccttttggcagttatgaataagtctctgcaggttagaaac
aaaattaacattattgtcgcttccaaacacccacgaactcaatggtttacgatcgacgaa
gccaaggaattggttgacaacggtttgggaattattccatgggcttccaacgatgacgga
gtggaaccggacgttgtttttgcagccggtggaacggaagcgactatggaaagtttggct
gctatttcgctcttgcatgaaagcttccctgaattgaagttccgctttattaatgtaatc
gatttgttgaaactgcgcaaaaaaggggataacgatgattatcgcggtctaagcgatttg
gaattcgaccattactttacgcgtgaaaaaccagtagtcttttccttccacggctttgaa
agtttggcacgcgacttgttctatgaccgccacaatcataatgttatttttcatggatat
cgtgaaaacggagacattacaactccgttcgatatgcgtgtcctgaatcatcttgatcgt
ttccaccttgccaaagacgcaatcaacgcaactaagtacgctgatgtggctggccaattt
gaccaacgaatggatgatatgttggccaaacataccgcttatatttgcgatcagggaaca
gacctgcctgaagtaacctcttggcagtggcaggatattaaataa

DBGET integrated database retrieval system