KEGG   Oenococcus oeni: OEOE_1199Help
Entry
OEOE_1199         CDS       T00408                                 

Definition
LysM repeat-containing muramidase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
ooe  Oenococcus oeni
Brite
Enzymes [BR:ooe01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     OEOE_1199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1134783..1135955)
Genome map
AA seq 390 aa AA seqDB search
MEAEIEKIEAENTANYSSKVSTFLNEIIESAINGWTQYKILPSLTAAQAILESGWGTSTL
ASEYHNLFGIKGSYNGQTVDMPTEEYYSGAYHEIDDYFRVYASDSESITNYEELLSENSR
YSNLIGETDAATAAEEIYEDGYATDPDYTEELEEIINEYNLTAWDSLAFKYSGTVVTTTG
STSTSTSSAASSASSVSSSSATSSSASSAASSASSVSSSSATSSSASSAASSASSVSSSS
ATSSSASSAASSASSVSSSSATSSSASSTSSSSTSSSSKSYTVASGDTLTSIAKAYGTTV
SAIATANNISNPDYIYVGEVLTIGSSTSTSTSTSSTSSSSTSSSSKSYTVASGDTLTSIA
KAYGVSISTLAKLNNISNTNLIYAGTTLKI
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
ttggaagctgaaattgaaaaaatcgaggctgagaatactgccaattacagtagtaaagtt
tcaacttttctaaacgaaattattgaaagtgcaattaatggctggactcaatataagatt
ttgccatcactaacagctgcgcaggcgattctcgaaagtggctggggcacttcgacgctt
gcgagcgaataccataatttgtttggaatcaaaggttcctataatggccaaactgttgat
atgccaacggaagaatattacagcggtgcttaccatgaaatagacgattatttccgggtt
tatgctagcgattctgaaagtattaccaactatgaagaattactgagtgaaaattctcgc
tatagtaatttgattggcgaaacggatgctgctaccgctgctgaagaaatttacgaagat
ggctatgcaactgatccagattatactgaagaattagaagaaatcattaatgaatataat
ctaacggcttgggatagtcttgcattcaaatatagcggtacggttgttactacaacaggt
tctacttctacttcgactagttctgcagccagttcagcttcatctgtttctagcagcagt
gcaacatcatcgagtgctagttctgcagccagttcagcttcatctgtttctagcagcagt
gcaacatcatcgagtgctagttctgcagccagttcagcttcatctgtttctagcagcagt
gcaacatcatcgagtgctagttctgcagccagttcagcttcatctgtttctagcagcagt
gcaacatcatcgagtgctagttctaccagtagtagttcaacgtcgagttcttctaagagc
tataccgtcgcttctggagatactttgacttcgattgcaaaagcctacgggacaactgtg
agcgcgattgccacagccaataatatatccaatccggattatatttatgttggtgaagtt
cttacgattggaagttctacttctacttctacttcgactagttctaccagtagtagttca
acgtcgagttcttctaagagctataccgtcgcttctggagatactttgacttcgattgca
aaagcctacggcgtaagtattagtactttggcgaaacttaacaatatctcgaatactaat
ttgatttatgctggtacgactcttaaaatatag

DBGET integrated database retrieval system