KEGG   Oenococcus oeni: OEOE_1248Help
Entry
OEOE_1248         CDS       T00408                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OEOE_1248
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_1248
   00620 Pyruvate metabolism
    OEOE_1248
   00650 Butanoate metabolism
    OEOE_1248
  Lipid metabolism
   00071 Fatty acid degradation
    OEOE_1248
  Amino acid metabolism
   00350 Tyrosine metabolism
    OEOE_1248
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OEOE_1248
   00626 Naphthalene degradation
    OEOE_1248
Enzymes [BR:ooe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OEOE_1248
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     OEOE_1248
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1166903..1169599)
Genome map
AA seq 898 aa AA seqDB search
MAVETKKITKKILTSDELKDKKETAKKYIGELVDKSRQALLEFSQYSQSQVDKIVAAMAL
AGSEHSLELAHFARNETGRGVVEDKDTKNRFASESVYNTIKNDKTVGVIDEDPITGKVQL
AAPLGILAGIVPTTNPTSTTIFKSLLTAKTRNTIIFAFHPQAQKSSVAAAKIVYQAARKA
GAPKDFIQWIETPSLENTTALMQNPEIASILATGGPSMVHAALTSGNPSMGVGAGNGAVF
IDHTARVRRAAEDLLLSKRFDNGMICATENSAVIEASVYDEFMKLMQEKGTYLVPKDDYK
KIADFVFSDKHAVNGPVAGMSGRWIAEHAGVTLPKGKDVLLFELDQDDIGEKLSSEKLSP
LLSVYKAADRKEAIKVVQRLLNYQGAGHNAAIQIGAQDDPFVKEYADAVSASRILVNQPD
SIGGVGDIYTDALRPSMTLGTGSWGKNSLSHNLSTYDLLNVKTVARRRNRPQWVRLPKDI
YYEKNAITYLQELPNVNRAFVITDHSLVKYGFVDRILEQFELRPDQVKTSIYSSVQPDPY
LSQAVEIAKQMQEFEPDTVIALGGGSSLDVAKISRFLYEYSQEPDHIGFLENIDDIKELF
KGLQQKFMDIRKRIVKFEHQNLTQLVAIPTTSGTGSEVTPFSVITDDETHVKYPLADYEL
TPQVAIVDPELVMTVPKRTLAWSGLDALSHSLESYVSVMSSEFTRPWALQAIKLIFENIV
DSYNYDPKHPTNRGAEAREKMHYAATLAGMSFGNAFLGINHSLAHKTGGEFGLPHGLAIS
IAMPHVIRFNAVTGNVKRTPFPRYEVYTAQKDYADIARHIGLSGKNDAELVEKLIAKIKE
LTDALDVNITLSGNGVDKKSFEHSLDQLVDLVYDDQCTPGNPRQPNLAEIRQLLIDQF
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atggcagttgaaacgaagaagattactaaaaagatactgacttccgacgaacttaaagac
aaaaaggagacagcaaaaaaatacattggagaattagtcgataaatcaagacaggcatta
ttagaattctctcaatatagtcaatcacaagttgacaaaattgttgccgcaatggcttta
gccggttccgaacattctttggaattagcacactttgctcgaaatgaaactggaagagga
gttgttgaagacaaagatacgaaaaatcgttttgcctcggaatctgtatataacacgatt
aaaaatgacaaaacagttggcgtaattgatgaagacccaatcactggcaaagttcagtta
gctgcaccacttgggattttagccggaattgttccaacgacaaatccaacgtctaccacg
atttttaaatcattgttaaccgctaagacacgtaatacgatcatttttgcttttcacccg
caagcacaaaaatcgtctgtagcggctgcgaaaattgtttaccaggcggctagaaaagct
ggagcaccgaaagatttcattcagtggatcgaaacgccttccttggaaaatacgactgct
ttgatgcaaaatcctgaaatagcttcaattttggctactggaggcccttctatggttcat
gccgcattaacatcgggaaacccttcaatgggtgttggggcaggaaatggagctgttttc
attgaccatacggctcgtgttcgtcgagcggcagaagacttgttgctatcaaaacgtttt
gataatggaatgatttgcgctacagagaattccgcagttatcgaagcttcggtttatgac
gaatttatgaaattaatgcaggaaaagggtacttatctcgttccgaaggatgattacaaa
aagatcgctgattttgttttcagcgataaacatgcagttaatggtccggttgccgggatg
agtggccgttggattgctgaacatgccggtgttactttgccgaagggcaaagatgttttg
ttgtttgagttggatcaagacgacattggcgaaaaactttcctcggaaaaacttagcccc
ttgctttcggtctataaagctgctgatcgtaaagaagcgataaaagttgttcaaagactt
ttgaactatcaaggagctggtcataatgcggcaatccagattggcgctcaagacgatccc
tttgttaaagaatatgccgatgcagtttctgcatctagaattttggttaaccagcccgat
tcaataggtggagtcggcgatatttatacagatgcattgcgtccaagtatgacgcttggt
actggttcatgggggaagaattcattgtcacataatttatcaacttacgatttgttgaat
gtcaaaacggttgcccgcagacgtaatcgtcctcaatgggttcgtcttccaaaagatatc
tactatgagaaaaatgccattacctatctgcaggaattaccgaacgtcaatcgggctttc
gttattaccgatcattcgttggtcaaatatggattcgtcgatcggattcttgagcaattc
gaattgcgtcccgaccaggttaaaacaagtatttacagttctgttcaaccggatccttat
ttgagtcaggctgttgaaattgcaaaacaaatgcaggagttcgaaccggatacagtaatt
gctcttggaggaggttcctctttggatgttgccaagatttcccgttttctttatgaatat
tctcaagaaccggaccacattggttttttggaaaacattgacgatattaaagaattgttt
aaaggattgcagcaaaagtttatggatattcggaaacggattgttaaattcgaacatcag
aatttgactcaactggttgctattccaacaacttcgggtaccggttcggaagtaacaccg
ttttcggttatcaccgatgatgaaactcacgttaaataccctttggccgattatgaatta
actccgcaagttgcaatcgttgatcctgaattggttatgactgtaccaaaacggaccctg
gcttggtctggactggacgccttatctcactcgcttgaatcctacgtgtcggttatgagt
tctgaatttacacggccgtgggctttacaggcaatcaaactgatttttgaaaacatcgtt
gattcctataattacgatccaaagcacccaactaatcggggcgccgaggcacgtgaaaaa
atgcattatgctgcaactttggccggcatgtctttcggaaacgccttcttgggtataaac
cattcactggcccataaaaccggtggagagttcggtcttcctcatggtttggcaatcagc
atcgcgatgccacatgtaattcgatttaatgcggttaccggaaacgtcaaacggactcct
tttcctcgttatgaggtttatacagcccaaaaagattatgccgatattgcgcgccatatt
ggcctcagcggtaagaacgatgccgaattggttgaaaaacttatcgccaaaatcaaggaa
ttaaccgatgccttggatgtcaatattactttgagcggcaatggagtcgataaaaagagc
tttgaacattctttggatcaactggttgatcttgtttacgatgaccagtgcacgccagga
aatccgcgacaaccgaatttagctgaaattaggcagttattgatcgaccaattttaa

DBGET integrated database retrieval system