KEGG   Oenococcus oeni: OEOE_1330Help
Entry
OEOE_1330         CDS       T00408                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Class
Metabolism; Overview; Degradation of aromatic compounds [PATH:ooe01220]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ooe00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ooe00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:ooe00625]
Metabolism; Xenobiotics biodegradation and metabolism; Naphthalene degradation [PATH:ooe00626]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1237877..1239019)
Genome map
AA seq 380 aa AA seqDB search
MNSSQNEFVDVLFEKEVMLMKPENTFNSKESVDVGGSERIPSEMRAWEVTSPAPIDSSPS
PIHFVKHPVPVPKTSEVLVRVISCGICHTDLHVAEGDLPVHHPHVIPGHEIIGRVVANGP
QAGRFNLGDRIGVPWLRWTCGVCTYCRSGKENLCPNSLYTGWDHDGGYAEYVTVPEGFAY
RIPSAFNSVTAAPLLCAGIIGYHAFRRANVPAGGRLGLYGFGGSAHLAAQIAIAQGIEVH
VFTRGKDAQRFALELGAASAQGVYDPSPVSLDSSILFAPVGDIVPKALENLAAGGTLALA
GIHLTDVPSLNYQNHLFHEKVLTSVESNTRRDGEEFLTLADRLKIHPKTTEYPFEKADEA
LRHLSHGDMQGACVLRISEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaagccaaaatgagtttgttgatgttttatttgaaaaagaggttatgcttatg
aaacctgaaaatacttttaattcaaaagaatctgttgatgttggcggttctgaaagaatt
cccagcgaaatgcgagcttgggaagtgactagcccagcgccaattgatagctcgccatcg
cccattcattttgtaaaacatccggttccggtccctaaaaccagtgaagtgttggttcgg
gttatttcgtgcggtatttgccacactgatctgcatgttgccgaaggtgatcttccggtt
catcatccccacgtaattcccggccatgaaattattgggcgggtcgtcgcgaacggccca
caagcaggtcgttttaatttaggcgatcggattggagttccttggttgcgttggacctgc
ggcgtatgtacttattgccgatccggcaaagagaatctttgtcctaattcgctttatact
ggttgggatcatgatggagggtatgccgaatatgtgactgttccagaaggatttgcttat
cggattccgtctgcttttaactcggtcactgctgcgccgctgctttgtgccggcatcatt
ggctatcatgcttttcgtcgggcaaatgttccggccggaggccgcctaggtctttatggt
tttggtggttctgctcatctggcagctcagattgccattgctcaaggtattgaagtccac
gtattcacgcgtggaaaagacgcacagcgttttgctttggaactaggtgcggcgtcggcc
cagggcgtttacgacccatctccggtctctttggattcatcaattctttttgctccggtt
ggcgatatcgtgccgaaagctttggaaaatttggcagccggcgggacattagcactagcc
ggtatccatttaaccgatgttccttcgctgaactaccagaatcatttgtttcatgaaaaa
gttcttactagtgttgaaagtaatacacgtcgcgatggtgaagaattcctgactttggcc
gatcgattgaagattcatccaaaaacaactgagtatccttttgaaaaagccgatgaagcg
ctgcgccatttgtcgcacggcgatatgcagggcgcctgtgttttgcgcatcagcgaagga
tga

DBGET integrated database retrieval system