KEGG   Oenococcus oeni: OEOE_1330Help
Entry
OEOE_1330         CDS       T00408                                 

Definition
Zn-dependent alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
ooe  Oenococcus oeni
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    OEOE_1330
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    OEOE_1330
  Lipid metabolism
   00071 Fatty acid degradation
    OEOE_1330
  Amino acid metabolism
   00350 Tyrosine metabolism
    OEOE_1330
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    OEOE_1330
   00626 Naphthalene degradation
    OEOE_1330
Enzymes [BR:ooe01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     OEOE_1330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1237877..1239019)
Genome map
AA seq 380 aa AA seqDB search
MNSSQNEFVDVLFEKEVMLMKPENTFNSKESVDVGGSERIPSEMRAWEVTSPAPIDSSPS
PIHFVKHPVPVPKTSEVLVRVISCGICHTDLHVAEGDLPVHHPHVIPGHEIIGRVVANGP
QAGRFNLGDRIGVPWLRWTCGVCTYCRSGKENLCPNSLYTGWDHDGGYAEYVTVPEGFAY
RIPSAFNSVTAAPLLCAGIIGYHAFRRANVPAGGRLGLYGFGGSAHLAAQIAIAQGIEVH
VFTRGKDAQRFALELGAASAQGVYDPSPVSLDSSILFAPVGDIVPKALENLAAGGTLALA
GIHLTDVPSLNYQNHLFHEKVLTSVESNTRRDGEEFLTLADRLKIHPKTTEYPFEKADEA
LRHLSHGDMQGACVLRISEG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaattcaagccaaaatgagtttgttgatgttttatttgaaaaagaggttatgcttatg
aaacctgaaaatacttttaattcaaaagaatctgttgatgttggcggttctgaaagaatt
cccagcgaaatgcgagcttgggaagtgactagcccagcgccaattgatagctcgccatcg
cccattcattttgtaaaacatccggttccggtccctaaaaccagtgaagtgttggttcgg
gttatttcgtgcggtatttgccacactgatctgcatgttgccgaaggtgatcttccggtt
catcatccccacgtaattcccggccatgaaattattgggcgggtcgtcgcgaacggccca
caagcaggtcgttttaatttaggcgatcggattggagttccttggttgcgttggacctgc
ggcgtatgtacttattgccgatccggcaaagagaatctttgtcctaattcgctttatact
ggttgggatcatgatggagggtatgccgaatatgtgactgttccagaaggatttgcttat
cggattccgtctgcttttaactcggtcactgctgcgccgctgctttgtgccggcatcatt
ggctatcatgcttttcgtcgggcaaatgttccggccggaggccgcctaggtctttatggt
tttggtggttctgctcatctggcagctcagattgccattgctcaaggtattgaagtccac
gtattcacgcgtggaaaagacgcacagcgttttgctttggaactaggtgcggcgtcggcc
cagggcgtttacgacccatctccggtctctttggattcatcaattctttttgctccggtt
ggcgatatcgtgccgaaagctttggaaaatttggcagccggcgggacattagcactagcc
ggtatccatttaaccgatgttccttcgctgaactaccagaatcatttgtttcatgaaaaa
gttcttactagtgttgaaagtaatacacgtcgcgatggtgaagaattcctgactttggcc
gatcgattgaagattcatccaaaaacaactgagtatccttttgaaaaagccgatgaagcg
ctgcgccatttgtcgcacggcgatatgcagggcgcctgtgttttgcgcatcagcgaagga
tga

DBGET integrated database retrieval system