KEGG   Oenococcus oeni: OEOE_1432Help
Entry
OEOE_1432         CDS       T00408                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ooe  Oenococcus oeni
Pathway
ooe00230  Purine metabolism
ooe01100  Metabolic pathways
Module
ooe_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    OEOE_1432
Enzymes [BR:ooe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     OEOE_1432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 AAA_22 AAA_16 AAA_28 PRK AAA_24 ABC_tran CPT Myosin_head Thymidylate_kin AAA_30 Zeta_toxin CoaE AAA_33 APS_kinase DUF2075 RsgA_GTPase Sigma54_activ_2 AAA_23 AAA_5
Motif
Other DBs
NCBI-ProteinID: ABJ57293
JGI: OEOE1432
UniProt: Q04E29
Position
complement(1345943..1346527)
Genome map
AA seq 194 aa AA seqDB search
MENENRVIVITGASGAGKTSVARYLRAKYSVPRVITHTTREPREGEIDGVDYYFETEDSW
GKNHFIEQVNYSGYKYGSSYEGLERAWAKSKRSNHPGVISLVVDTIGAITYKETLKDQAI
IWFVTVSDVAGLRNRLIARGDNPKRVVERTSSNDFERDMHLPEKLKNRATVIINDNWQLT
QEGADKFINKLFYM
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacgaaaatcgcgtaatcgtaatcactggggcttccggagctggtaagacatca
gttgctcgttatcttcgtgctaaatacagtgttccgcgggtgatcactcatacaacccgc
gagccaagagaaggtgaaatcgacggtgtcgactattactttgaaaccgaagattcatgg
ggcaagaatcactttattgaacaggttaattattctggttacaagtatggttcctcttat
gaaggactcgaacgggcctgggccaagtcgaaacgatcgaatcatccgggtgttataagc
ctggttgttgatacgattggggcaatcacatacaaggaaaccttaaaagaccaagcgatt
atctggtttgtaacagttagtgatgtcgctggtttgagaaatcgtttgattgcgcgtgga
gataatccaaaacgtgtcgtcgaacgaactagttccaacgacttcgagcgcgatatgcat
cttcctgaaaaacttaaaaatcgagcaacagtcattattaacgataattggcaattgact
caagaaggggccgataaatttattaataaactattttacatgtag

DBGET integrated database retrieval system