KEGG   Oenococcus oeni: OEOE_1545Help
Entry
OEOE_1545         CDS       T00408                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ooe  Oenococcus oeni
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    OEOE_1545
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    OEOE_1545
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    OEOE_1545
Enzymes [BR:ooe01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     OEOE_1545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1464848..1466311)
Genome map
AA seq 487 aa AA seqDB search
MKFQSTRGQAAIVDGADALINGLAPDGGLYVPLVFPTIDFDWEKLQDENYLQIGQLILST
FFDEFSNNEITDFLKSAYRDFDDSKIVEIHQLDDKRNLLELFHGPTLAFKDMALSLLPYL
LTAAVKKNGSSKTMVILTATSGDTGGAALKGFNDVPQTKIVVYYPSVGVSKLQRQQMTTA
DGKNTHVVAVTGNFDDAQKAVKNLLTDHRLAQKMSAASLGFSSANSINIGRLVPQIIYYV
YAYAQLVKNNRLSAGEKLDISVPTGNFGDILAAYWAKKLGVPIGKLTVASNANHVLTDFF
ATGIYDADRSFQVTSSPAMDILVSSNLERLLFDIAGPKAVAAWMKDLTDKRRYQLDDFSL
SRLQDSFNAAFADSKTTAQTIQETFQQNNYLLDPHTAVAVSVNKDFPSNRQQLIVATASP
FKFAETVLKALGKESDNDPQMNLNLISDLSGQRVPLAISGLFDKKIIHTKKLAIKDLLTD
LNEALGI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttcaaagtacacgcggacaagcagcgattgttgatggggctgacgcccttatc
aacggattggcaccggacggcggactttatgtaccgcttgtttttccaacaattgatttt
gattgggaaaaattgcaggatgagaattatcttcagattggtcaattaattctttcgact
ttttttgacgaattttcaaataacgaaataactgattttttgaaatcggcttatcgggat
tttgatgattcaaaaattgttgaaatccatcagcttgatgacaaacgaaatttattggaa
ttgtttcatggaccgactttggcttttaaagatatggcgctctcccttctaccttattta
ttgactgcggctgtcaaaaaaaacggcagttcaaagacaatggttattttaacggcaact
tccggtgataccggtggtgcggctttaaagggtttcaatgatgtcccgcagacaaaaatt
gttgtttattatccgtcggttggtgtttccaaattacaacgtcaacagatgacgacagct
gacggaaaaaatactcacgtggttgctgttactggcaattttgacgatgctcaaaaagcg
gttaaaaatcttttgacggatcatcggttggctcaaaaaatgtcagcagcttcgcttggt
ttttcctctgcgaattctattaacatcggtcgtttggtacctcaaatcatttactatgtg
tatgcttatgctcaattagttaagaataatcgcctatcggctggtgagaaattggatata
agcgttccgactggtaattttggtgatatcctggctgcttactgggccaaaaaacttggt
gtcccaattggaaaattgaccgttgcttctaatgccaatcatgttctgaccgactttttt
gcaaccggaatttacgatgccgatcgctcctttcaagttaccagcagtccggcaatggat
attcttgtttccagtaatttggaacggctcttatttgacattgccggccccaaagcggtc
gccgcttggatgaaagacttgaccgacaagcgtcgatatcaactcgatgatttttctttg
agcagacttcaggattcttttaatgcggcgtttgccgattccaaaacaaccgctcaaaca
attcaggaaacatttcagcagaataattatttgttggaccctcatacagcggttgctgtt
tctgttaacaaagattttccaagcaataggcaacaactgattgttgcaacagccagtccc
tttaagtttgccgaaactgttttaaaagcgctcggaaaagaatccgacaatgatccacaa
atgaatttgaatctcatatctgatttgagtggccaaagagttcctttggcgattagcgga
cttttcgataaaaaaattattcatacaaaaaaattggcaatcaaagatttgctaaccgat
ttgaatgaagctctcggaatttga

DBGET integrated database retrieval system