KEGG   Oenococcus oeni: OEOE_1599Help
Entry
OEOE_1599         CDS       T00408                                 

Definition
UDP-N-acetylmuramyl tripeptide synthase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
ooe  Oenococcus oeni
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:ooe00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    OEOE_1599
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    OEOE_1599
Enzymes [BR:ooe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     OEOE_1599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1514347..1515684
Genome map
AA seq 445 aa AA seqDB search
MFAGSSSYILLHKILHRGGTSLPGKIAYRIDPTFLEEFRDQIETVIVSGTNGKTLTTALC
ARVLKKTNRVVVTNNSGSNMIQGIVAALLSQKDKIKKSIRHGTIPIAVLEVDEANVKEVA
KILQPTHFVLTNIFRDQMDRYGEIYTTYEKITDGIKTAPKAKVVANGDSPIFARKPYKNQ
AVYFGFTHKKSVGDLRAPNNTDGVLAPTNDQVLHYHYLTYANLGDYFTKDGSFKRPQLKY
SVNKINSLTPSKSEFEIAGNKFTLPLGGLYNIYNALAAYSLGREFQISAEDIFNALNEDS
RIFGRQEQLTIGSHLVTIVLIKNPVGANSVIDMMMTDPEEFSLVTLLNANYADGIDTSWI
FDAEFEKLHQTALKKIIVGGQRYKDFSVRLKMAGFKNQIVEQDFAKLIDRIKELPTKNVY
VAATYTSMLMFREELAKAGLAKESF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgccggctcaagcagctacatacttttacataaaattctccatcgcggtggtact
tcgcttccgggcaagatcgcttatcggattgatccaacttttcttgaagaatttcgcgat
cagattgaaacggtaattgtgagcggtacaaacggtaaaacgttgacaactgctctttgc
gcaagagttcttaaaaaaacaaatcgtgtcgttgtaacaaataattccggttcaaatatg
attcaaggaattgtcgccgctctactttcccagaaagacaaaattaaaaaatcaattcgt
cacggcacgattccgattgcagtattagaagtagatgaagccaatgtaaaagaagttgca
aaaatcttacagccaactcattttgttttgacaaatatttttcgcgaccaaatggatcga
tacggcgaaatatatacaacttacgaaaaaataacagacggaatcaaaactgcaccaaaa
gcaaaggtcgttgccaacggggattcaccaatctttgctcgaaagccctataaaaatcaa
gctgtttattttggtttcacccacaaaaaatcagttggcgacctgcgtgctccaaataat
accgatggagtactggcaccgactaacgaccaggttctccactatcattacttaacatat
gccaatcttggagattatttcacaaaagatggttctttcaaacggccacaactcaaatac
tcggtgaacaaaattaattcattaactccatcgaaatcggaatttgaaatagctggaaat
aaattcacattaccgctgggcggtctttataatatttataatgctttggccgcttattct
ttaggacgggaattccaaatttccgctgaagatattttcaatgctttaaacgaagattca
agaatttttggtcgtcaggaacaattaacaattggcagccacttggttacgattgttttg
ataaaaaatccggttggagctaactctgtaatcgatatgatgatgaccgatccggaagaa
ttcagtttggtaactttactaaacgctaattatgccgacggtatcgacacaagttggatc
ttcgatgctgaattcgaaaagctacaccagacggccctgaaaaaaattattgtaggcgga
cagcgttataaagacttcagtgttcgactaaaaatggcaggctttaaaaatcaaattgtc
gaacaggattttgccaagttaatcgaccgaatcaaagagttgccaaccaaaaacgtatat
gtcgctgcaacttatacaagtatgttgatgtttcgtgaagaattggccaaagccggtttg
gcgaaggagagtttttaa

DBGET integrated database retrieval system